KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1024Help
Entry
VCLMA_A1024       CDS       T01871                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcl01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vcl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1146291..1147700)
Genome map
AA seq 469 aa AA seqDB search
MSEQLSEHISVQTAQMAQVLVKIVNDKYQWIEERKTKQPLASFHPLLTRSERDFYQALSG
DNTVFILECKKASPSKGLIREEFDLDYIASVYGEYANAISVLTDEKYFQGRFEFLPQVRA
QVTQPVLCKDFMVDPYQVYLARHYQADAILLMLSVLNDDQYRELAAVAHDLGMGVLTEVS
NEQELERAIALQAKVIGINNRNLRDLTTDLNRTKQLAPLIPQGTIIISESGIYTHQQVRD
LAQFANGFLIGSSLMAQSNLELAVRKIVLGEHKVCGLTHPDDAVKAYQAGSVFGGLIFVE
KSKRVVDVEQARLTMSGAPLQYVGVFQNHPAAQVADIATKLGLFAVQLHGEEDSAYVSEL
RAALPESIEIWKAYGVADALPELLPEHIDRHLLDAKVGEQSGGTGHSFDWRLLPKHSDLM
LAGGLSAENVAQAAQLGCRGLDFNSGVESAPGKKDANQLQQVFQQLRNY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagttgtctgagcatatttccgtacaaaccgcgcaaatggcgcaagtgctg
gtcaaaatcgtcaatgataaataccaatggattgaggagcgcaaaaccaagcaacctctt
gcgagctttcatccattactgactcgctcagagcgcgatttctatcaagccttgagcggc
gacaacaccgtattcattctcgaatgcaaaaaagcctcaccgtcgaaggggctgatccgc
gaagagtttgatctcgattacatcgcctccgtgtatggcgagtacgccaatgccatttcg
gtactgaccgatgaaaagtatttccaaggtcgttttgaatttttgccacaagtgcgcgct
caggtaactcagcctgtcttgtgcaaagattttatggtcgacccgtatcaggtttatctg
gcacgccattatcaagcggatgcgattttgctgatgctgtctgtgctcaatgatgatcaa
tatcgtgaactagctgctgtggcgcacgaccttggtatgggcgtgctcaccgaagtcagc
aacgagcaagaactggaacgtgcaattgctctgcaagcgaaagtcatcggcatcaataac
cgcaatctgcgtgatttgaccaccgacctgaatcgcaccaagcagttggcgccgctcatt
ccacaaggcaccatcattatttccgaatccggtatttatacccatcagcaggtgcgtgat
ttggcccaatttgccaatggtttcttgattggtagctcactgatggcgcaaagcaatctt
gaactggcggtgcgaaaaattgtgctcggcgaacacaaggtgtgcggtttgactcatcct
gatgatgcggttaaagcctaccaagccggttccgtttttggtggattgatttttgttgag
aagtccaaacgcgttgtcgatgtagaacaagctcgcctgacgatgagcggtgcaccgcta
cagtatgtcggcgtgtttcaaaatcacccagcggcgcaagtcgccgacattgcaaccaaa
cttggcttatttgcggtgcaactgcacggtgaggaagattctgcgtatgtaagcgaactg
cgcgcagcccttccagaatccattgaaatttggaaagcctatggcgtggctgatgccttg
ccagagctactgccagagcacatcgataggcatctgctcgatgcaaaagtcggcgaacag
agtggcggcacaggacacagttttgattggcgcttgctgccaaaacacagcgacctgatg
ctcgccggtggcttgagcgccgagaatgtcgcccaagcggcgcaacttggctgccgcgga
ctggatttcaactctggcgtggaaagcgctccgggtaaaaaagacgccaaccagttacaa
caggttttccaacagttacggaattattag

DBGET integrated database retrieval system