KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1353Help
Entry
VCLMA_A1353       CDS       T01871                                 

Definition
6-phospho-beta-glucosidase bglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A1353
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VCLMA_A1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1545973..1547409)
Genome map
AA seq 478 aa AA seqDB search
MAKSIFPNDFLWGGAVAAHQVEGGWDQGGKGVSIVDVLTRGAHEVPRRITDGVMEGEFYP
NHQAVDFYHHYKEDIALFAEMGFKCFRTSIAWTRIFPNGDEAEPNEAGLQFYDDLFDELL
KHKIEPVITLSHFEMPLHLVKQYGSWLNRDLIDHFTKFAQVVMTRYQHKVKYWITFNEIN
NQRNWKLPIFGYCNSGMLYAEQDHPEQAMYQVLHHQFVASALVVKLGHEINPDFKIGSMI
HMMPLYPATSRPEDVLLAQELMREKYLFSDVQVRGYYPSYLRKEWQRKGIEIEMQAGDEQ
ILRQGCADYLAISYYMTNIVSAAPEQEGETTSLFETSRLNPYLPASDWGWQIDPQGLRYA
LSELYERYQKPIFVVENGLGALDTVEADGSINDDYRIRYLSEHIAAVKQAIDYDGVDVMG
YTPWGCIDCVSFTTGEYKKRYGFIYVNKHDDGSGTMARAKKKSFYWYQQVIASNGEKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctatttttcctaacgattttttgtggggtggtgcggtagcggcgcatcaa
gtggaaggcggttgggatcaaggtggtaaaggcgtgagcattgttgatgtgctgactcgc
ggtgcgcacgaagtaccacgccgtattaccgatggggttatggaaggcgaattttaccca
aaccatcaagcggtcgatttttatcatcactataaagaagatatcgcgctgtttgctgag
atgggctttaaatgtttccgtacgtctattgcgtggacacggattttcccgaatggcgat
gaagccgagcccaatgaagcaggtttacagttttatgatgatctgtttgatgagctttta
aagcataagattgaacctgtcattacgttgtcacattttgaaatgccgctgcatctggta
aagcagtatggcagttggctcaaccgcgatttgattgatcacttcaccaaatttgcgcaa
gtcgtgatgacccgttaccagcataaggtgaaatattggatcacctttaatgaaatcaat
aaccaacgcaactggaagctgccgatctttggttattgcaactcaggtatgctttacgct
gagcaagaccacccagaacaagccatgtaccaagtgctacatcaccaatttgttgccagc
gcattagtggtgaaactggggcacgagatcaatccggattttaaaattggcagcatgatc
catatgatgccgctgtatcctgccacctcacgtccggaagatgtgttgttggcgcaagag
ttgatgcgtgagaaatatctgttcagtgacgtacaggttcgtggctattaccctagttat
ctgcgcaaagagtggcaacgcaaaggcatcgagattgagatgcaagctggtgatgagcag
atcctgcgccaaggctgcgccgattatctcgccatcagttactacatgactaatattgtc
tctgcagcgccagaacaagagggcgaaaccacctctttgtttgaaaccagtcgcttaaac
ccgtatcttccagcgtctgattggggatggcagattgatccacaaggtttacgttatgcg
ctttctgagttgtatgagcgttaccaaaaaccgatttttgtggtagaaaatggcctcggc
gcgctagacaccgtcgaagcggatggttcaatcaacgatgattaccgaattcgctacctc
tctgagcatatcgcggcagtcaaacaagcgatcgactatgacggtgttgacgtgatgggt
tataccccttggggctgtatcgactgtgtatcgttcaccactggcgaatacaaaaaacgc
tacggttttatctatgtgaataagcacgatgatggcagtggcaccatggcgcgcgctaag
aaaaagagcttctactggtatcaacaagtgatcgccagtaacggtgaaaagctttaa

DBGET integrated database retrieval system