KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1479Help
Entry
VCLMA_A1479       CDS       T01871                                 

Definition
Alpha-1,6-galactosidase, putative
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VCLMA_A1479
  Lipid metabolism
   00561 Glycerolipid metabolism
    VCLMA_A1479
   00600 Sphingolipid metabolism
    VCLMA_A1479
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VCLMA_A1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1692743..1694479)
Genome map
AA seq 578 aa AA seqDB search
MSHLRLANGREILAQQADIELEISDNELSAQYIGLHNRPFERRYPLFSTVLDVESDARLV
GDGFQMLSQASGTLSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTS
CRRFAGFFEVHRHPQHWILSAFIDGEETRPQDWVTNQLESVICLEGESMSELYQAYAEAI
SRHHPPRPHLKDPAPMGWCSWYAYYAEVTEQDIKDNVAVLAQRHPELEWVLLDDGYQAFM
GDWLTPSQKFPSGIEQVIADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPL
KAEEITYGGWRCTPWYVLDGSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRF
QSGVTGVEAYRMGMQAIAEGAGDGWLLGCNAPMWPSLGLVDAMRVSDDVERNADRFCQIA
RETLMRSWQHRQLWQIDPDCLTLTSLPNQSADRASYEFHRNLLLASGGLLLSGDPLPKLT
PFAKQSLKRLLKRFQYSQKAAKITSLSMRHAFLPLTDKNDLHCLFNFNGKAQEFTLVANH
PVQWYDYWTGEQLSSEPSKLLIVNLEKGLQSRAIFTVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagccacttaagactagccaatgggcgagagatcctagcgcagcaagccgatattgaa
ctggagatttcggacaatgagctctccgcacagtatattgggttacacaatcgtcctttt
gaacgccgttatccgctatttagcacggtgttggatgtcgagtcagatgcgcgcttggtc
ggtgatggtttccaaatgctctcacaagcctctggaacgctaagccatatccaagaagtc
gggcgttgtcctgataacaatctcagttaccgcatctaccctcatgatgcgccaaagcgt
ttttacaatactttgatgatagaggccgctggccgttatttgttgtttggttttacttct
tgccggcgatttgcgggcttttttgaagtgcatcgtcatccgcaacactggatactgagt
gcttttattgatggagaagagacacgtccgcaagactgggtcaccaatcagttagagtcg
gtgatttgcttagaaggtgaatccatgtcggagctttaccaagcctatgcagaggcgatc
tcgcgccatcatccaccaagaccccatctcaaagaccctgcaccgatgggctggtgttct
tggtatgcctactatgcagaagtcaccgaacaagacatcaaagataacgtggcggtatta
gcacagcgtcaccctgagctggaatgggtgctattggatgacggctatcaagcctttatg
ggcgattggcttacgccatcccaaaaattccccagtggtattgagcaagtgattgccgat
attcgcgcacaaggtaaaaagcccgctatctggcttgccccttttatcgcggaagcggat
tctgcggtctttcgtcagcacccagactggtttgtgaaaaatgccgcaggtcagccactc
aaagccgaagagatcacttatggcggttggcgctgtacgccttggtatgtgttggatggt
tctcatccggatgtgcaagagcacttgacccaagtggtgaaaaccctgcgtgaagagtgg
ggcgttgaactgtttaagctggatgccaactactggggaacgctacaaggccagcgtttt
caatcgggtgttacgggtgtagaagcgtatcgaatgggcatgcaagccatcgcggaaggc
gcaggcgatgggtggctactcggttgtaatgcgccgatgtggccttcactgggtttggtg
gatgcaatgcgtgtgtcggatgatgtagagcgcaatgccgatcgcttttgccaaattgcg
cgtgaaaccttaatgcgcagttggcagcaccggcaactgtggcaaatcgatccggattgc
ttaacgctcacctcgctgcccaatcaaagtgccgatcgcgccagctacgaattccaccgt
aatttgctgcttgccagcggtggtttgctattgtcaggcgacccactgccgaaattaaca
ccgtttgcaaaacagagcctgaaacgtttactcaaacgattccaatacagtcagaaggcg
gccaaaatcacttccttgagtatgcgccatgccttcttaccgctgaccgataagaatgat
ctgcactgcttgtttaacttcaacggtaaagctcaggagtttaccttggtcgccaatcat
ccggtgcaatggtatgactattggacaggagagcaattaagcagcgaaccttccaaactg
ctcatcgttaacttagagaaggggttacaaagccgcgccatttttacagtgggttag

DBGET integrated database retrieval system