KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1800Help
Entry
VCLMA_A1800       CDS       T01871                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VCLMA_A1800
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VCLMA_A1800
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VCLMA_A1800
Two-component system [BR:vcl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VCLMA_A1800
Bacterial motility proteins [BR:vcl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VCLMA_A1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2051847..2052980)
Genome map
AA seq 377 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGKEAVEKAARLKPDVITMDIEMPV
MDGISAVREIMANNPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVLSIASKKMFLRRPAAPRPAPTASIAASSSLSQERAAATSPLGNRPSTALSAATR
FKASGKKYQLTAIGTSTGGPVALQKILTKLPVNYPHPIVLIQHMPATFTAAFASRLNSLC
KIEVKEAEDGDMLRPGVAYLAPGGKQMMLDGRPGAARLRIIDGGDRMNYKPCVDVTFGSA
AKIFGDKVLSMILTGMGADGREGARMLKQAGATIWAQDEESCVVYGMPQAVAKAGISTED
LPLERIAERMLVEVGLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtattagttgttgatgattcgagttttttccgtcgtcgcgtgagtgaa
atcatcaactccgaatcgcgcttagaagtcattgatgttgctgtaaatgggaaagaggcc
gtagaaaaggccgctcgactcaagccagatgtgatcactatggatatagaaatgcccgtc
atggacggcatttccgctgtccgagaaatcatggcaaataatcccgtgcccattttgatg
ttctcttcattgacccatgatggcgcaaaagccacattggatgcactggatgctggcgcg
ttagactttttacctaagaagtttgaagatatcgcgcgcaaccgggatgaagccgtcaca
ctgttacagcagcgtgtgctttctattgcgtcgaaaaagatgtttctacgtcgccctgca
gctccacgccctgcgcctacagcatcaatagccgcgagttcgtcactcagccaagaacga
gcggcagctacctcacctttgggaaaccgaccctcgacggcgctttcagcagcaactcgt
tttaaagcttcgggtaaaaaataccagttgaccgcaataggaacctcaaccggtggacct
gtagccttgcagaaaatattaactaagctccccgtaaattatccacaccccatagtgttg
attcagcatatgccagcgacatttacggctgcttttgctagccgtctcaattcgctatgc
aaaattgaagttaaagaagcggaagatggagatatgctgcgtccgggtgtcgcttattta
gcaccaggtggtaagcagatgatgctggatggtcgacccggtgcggctcgcctacgcatt
atcgacggtggcgaccgcatgaactataaaccgtgtgtggatgttacttttggctccgcg
gcaaaaatctttggtgacaaagtactgtccatgattttgaccggaatgggtgcggatgga
cgtgaaggtgcgcggatgctgaaacaagcaggagccaccatttgggcacaagatgaagaa
agttgtgtcgtgtatggcatgccacaagctgtcgctaaagcaggaatttcaacggaagat
ctaccgctggagagaatcgcagagcgtatgttggtagaagtcgggctcgcctaa

DBGET integrated database retrieval system