KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1821Help
Entry
VCLMA_A1821       CDS       T01871                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCLMA_A1821
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VCLMA_A1821
   00640 Propanoate metabolism
    VCLMA_A1821
   00660 C5-Branched dibasic acid metabolism
    VCLMA_A1821
Enzymes [BR:vcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VCLMA_A1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(2079484..2080650)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKAFAQKWLGKNLVTYQTDANGQPVSKILVEEASNIANELYLGAVVDRSTRR
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGEMFAQYDLALLEINPLVITAEGNLLCLDGKINIDSNAMYRQPKLRQMHDASQEDA
REAHAAKWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDTNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNAELGRKV
LAESGLDIIAAVSLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcaagctaaacagctgtttgcagaattcggtttgcctgtaccg
gaaggttatgcttgtgatacgccacaagaagcgtttgaagctgcaggacgcatcagcaca
gccaagaaagtcgtaaaatgccaagttcacgcaggtggacgtggtaaagcaggtggcgtt
gaactgcatgacactaaagaaggtgtaaaagcgtttgcacaaaaatggctaggtaagaac
ctagtaacttatcaaacggatgcaaatggccaaccggtttcaaaaattttggttgaagaa
gcatcaaatatcgctaatgagctttatcttggtgcggtagttgaccgttctacacgtcgt
atcgttttcatggcatcgactgaaggtggcgtggaaattgagaaagtggcagaagaaact
ccagaactgatccacaaagcggcaattgatccactggttggcccacaagcctaccaaggt
cgtgaattggcgttcaagctaggcctgcaaggtgatcaaatcaaacagttcgtgaaaatc
ttcatgggcttgggtgaaatgtttgctcaatatgatctcgcactgctggaaatcaacccg
ctggtgattactgcagaaggtaacttgctgtgccttgatggcaaaatcaacatcgactcc
aatgcgatgtaccgtcaacccaaactgcgtcaaatgcacgatgcttctcaagaagatgcg
cgcgaagcacacgcagcgaaatgggagcttaactacgttgcgctggatggtaacgtaggc
tgtatggttaacggtgctggccttgcgatgggtacgatggacattgttaacttgcatggc
ggaaaacccgcaaacttccttgatgttggtggcggcgcgaccaaagagcgtgttgcagaa
gccttcaaaatcatcttgtctgataccaatgtaaaagccgtactggtgaacatctttggt
ggcattgtgcgctgcgacatgattgcagaaggcattatcggtgcggttaaggaagttggt
gtaagtgttccagtggttgtgcgtcttgaaggtacaaacgcagaacttggacgtaaagtg
ctggcagaatcaggtctagatattattgcagctgtatctttgacagacgcagcgcaaaaa
gtagttgccgcggcggagggcaaataa

DBGET integrated database retrieval system