KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1822Help
Entry
VCLMA_A1822       CDS       T01871                                 

Definition
Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCLMA_A1822
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VCLMA_A1822
  Amino acid metabolism
   00310 Lysine degradation
    VCLMA_A1822
Enzymes [BR:vcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VCLMA_A1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2080818..2082032)
Genome map
AA seq 404 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL
EQEGATVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASLTEESNDALSPAVRRL
LAEHNLEASQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAPVAALAPVVGRSEKRVPM
TRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVFEKRHGIRLGFMSFYVKA
VTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVTPVLKNCDTLSLAQIEKGIKE
LAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGK
IEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattctggttccagatttgcctgaatcagttgcggatgccacggttgcg
acgtggcataaaaagccgggtgacatggttgctcgcgatgaagtgatcgttgaaattgaa
actgacaaagtggtgctggaagttccagcacccgatgccggtgttctggaagctattttg
gaacaagaaggtgcgacagtgctttctaaacaactgctggcacgtttgaagccaggcgct
gtggcgggtgaaccaacccaagacactccagatgctactgagccatcaccagataaacgc
cataaagcatcactaactgaagaaagcaatgatgcgctaagccctgcggttcgtcgcctg
cttgctgaacataacttggaagcaagccaagttaaaggttctggtgtgggtggtcgtatt
acccgcgaagacatcgaagctcacttagccgcgaacaaagccaaaccagctgcgaaagct
gaagcccctgtcgcagcgttggctcctgtcgtcggtcgcagtgaaaagcgcgtgcctatg
acacgtctgcgtaagcgtatcgctgagcgtctgttggaagcgaaaaataatacggctatg
ctgacgacgtttaatgaagtcaacatgaaacctatcatggacatgcgtaagcaataccaa
gatgtgttcgaaaaacgtcatggcatccgtctgggctttatgtcgttctacgtgaaagcc
gtcactgaagcgctgaagcgttacccagaagtgaacgcgtctatcgatggtgatgatctg
gtttaccacaactactttgatgtgagcattgccgtatcaaccccacgtggtctggttact
ccagtactgaaaaactgcgataccttgagtttggcgcaaattgaaaaaggcattaaagag
ctagcagaaaaaggtcgtgacggtaaattgaccgtagacgaactgactggcggtaacttt
accattaccaacggtggtgtgtttggttcactgatgtcaacgcctatcattaacccgcca
caagcggcgattctgggtatgcataagatccaagaccgcgccatggtggtggatggcaag
attgaaatcctgccaatgatgtatctagcgctgtcttatgaccaccgttcaatcgatggt
cgtgagtcggttggtttcctagtgaccgttaaagagttgctagaagatccagcccgtctg
ctgctcgatgtttaa

DBGET integrated database retrieval system