KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1909Help
Entry
VCLMA_A1909       CDS       T01871                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VCLMA_A1909
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VCLMA_A1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2162234..2163106
Genome map
AA seq 290 aa AA seqDB search
MIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNITLSPAL
ADVALEDNLIYKAAMALKNAAQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVALNYLWQ
TGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAVEPEEKWYLVVRPAVSIATKD
IFTHPQLMRNTPKRDLASLLATPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLTGTGSC
VFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKIRPY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatccacggcaccaccgtgtggccttcaccggccaaactcaacctgtttctttacatc
acaggtcgtcgagctaacggctatcacgatcttcagaccttgtttcagtttctcgatcac
ggtgatgagttaaccattaccgccaacaacagcggcaacatcaccctctctcctgctctg
gccgatgtcgcgttagaagataacctgatttacaaagccgcgatggcactcaaaaatgcg
gcgcaatcgccactcggcgcagacattcaactgcacaaggtgttgcctatgggcggcgga
attggtggcggatcatccaatgcggccactaccttagtcgcactcaattacttgtggcag
actggacttagcgatgatcaattggctgagattggtctggcactcggagcggatgtccct
gtctttactcgtggttttgcggcttttgctgaaggagttggcgaagaattatccgcagta
gagccagaggaaaaatggtatctcgtggttcgccctgcggtcagcatcgcgacaaaagat
atttttactcacccacaactgatgagaaacacgccaaagcgtgatctggcaagccttctt
gccaccccgtacgaaaacgattgcgaaaaaattgtccgatcactgtaccccgaggttgat
aagcaactttcatggctgctacaatacgcgccgtcaagattgaccgggacgggatcttgc
gtttttgctgagttttcgagcaggaaagatgcacaggccgtctttgctcaattatctgac
aacgtcttagcgtttgtcgcccaagggcgcaatgtttcaccgctcagaaagacgttagct
gactaccaatcagctaaaatccgaccttactaa

DBGET integrated database retrieval system