KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1909Help
Entry
VCLMA_A1909       CDS       T01871                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vcl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2162234..2163106
Genome map
AA seq 290 aa AA seqDB search
MIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNITLSPAL
ADVALEDNLIYKAAMALKNAAQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVALNYLWQ
TGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAVEPEEKWYLVVRPAVSIATKD
IFTHPQLMRNTPKRDLASLLATPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLTGTGSC
VFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKIRPY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatccacggcaccaccgtgtggccttcaccggccaaactcaacctgtttctttacatc
acaggtcgtcgagctaacggctatcacgatcttcagaccttgtttcagtttctcgatcac
ggtgatgagttaaccattaccgccaacaacagcggcaacatcaccctctctcctgctctg
gccgatgtcgcgttagaagataacctgatttacaaagccgcgatggcactcaaaaatgcg
gcgcaatcgccactcggcgcagacattcaactgcacaaggtgttgcctatgggcggcgga
attggtggcggatcatccaatgcggccactaccttagtcgcactcaattacttgtggcag
actggacttagcgatgatcaattggctgagattggtctggcactcggagcggatgtccct
gtctttactcgtggttttgcggcttttgctgaaggagttggcgaagaattatccgcagta
gagccagaggaaaaatggtatctcgtggttcgccctgcggtcagcatcgcgacaaaagat
atttttactcacccacaactgatgagaaacacgccaaagcgtgatctggcaagccttctt
gccaccccgtacgaaaacgattgcgaaaaaattgtccgatcactgtaccccgaggttgat
aagcaactttcatggctgctacaatacgcgccgtcaagattgaccgggacgggatcttgc
gtttttgctgagttttcgagcaggaaagatgcacaggccgtctttgctcaattatctgac
aacgtcttagcgtttgtcgcccaagggcgcaatgtttcaccgctcagaaagacgttagct
gactaccaatcagctaaaatccgaccttactaa

DBGET integrated database retrieval system