KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2035Help
Entry
VCLMA_A2035       CDS       T01871                                 

Definition
Exodeoxyribonuclease V alpha chain RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VCLMA_A2035
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VCLMA_A2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2301794..2303914)
Genome map
AA seq 706 aa AA seqDB search
MMFWDSEVAKRLLAQGALRPLDVQFARFIGKQAALAGHNAAESELLSVLSAALSAELGRG
HICLPLWDAQGNRCDLAALIGLYGEASLQHSERWLALDWQALLQASPLVGKQGEAVPLMF
DGARLYLHRYWHYEKQLAARLTELAAPQRLSPAELANLRERLNTLFARDYLGLWQALQQK
PLSSVERIQLLNDRLDVVESDALDWPAIEAVVEKAQRAADLQALEQLIPLTHCLNWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALISQSMAQGKVPEIKLIAPTGKAAARLTES
MGKAVSQLAIEPEIAAAIPSTSSTIHRLLGAIPGSAEFRHHARNPLHLDLLVVDEASMVD
LPLMVKLVEALPKHARLILLGDKDQLASVEAGAVLGDICTFLNQGYGNEQGAQLAELTGF
ASLRQTASKTVNPVADCLCMLQKSYRFDARSGIGQLAKAINSGSPARVETVWQQSFSDIE
HFALSGEHYQQLLQTLVQAYRPYLNLLNQSTEQFESTKQTMLTLAKSALDAFSRCRLLCA
LREGDFGVMGLNTRIERALNAHKLIKTQEEIWYHGRPIMVTCNDHGLGLYNGDIGLCMRD
RDDDQGRLKVYFELPDGSIEAVLPSRVPQHETAYAMTIHKSQGSEFDLTLLILPPDYSPI
LTRELVYTGITRAKKQLKLYCDNKVLQRAIKVKTQRASGLVARLEQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttgggatagtgaagtagcgaaacgtctgctggcacaaggcgcgctgcgtcct
ttggatgtgcagtttgcccgctttattggcaagcaagccgcattggcagggcacaacgct
gcagaaagtgaactgttgagtgtgctgagcgcggcgctcagtgcagaacttgggcgtgga
cacatctgtttgccactgtgggatgcacagggtaatcgctgcgatctggcggcgctgatt
ggtctttatggtgaagcgagtttgcagcacagtgaacgctggttagcgttagactggcaa
gccttactgcaagcctcgccgttggtggggaagcaaggtgaagcggtgccgttaatgttt
gatggcgcaaggctctatctgcatcgctactggcattatgaaaagcaactggcagcgcga
ttgactgagttggccgcaccccaacgtttaagccctgctgaactggctaacttgcgtgaa
cgcctgaataccttatttgcccgcgactatttaggcttgtggcaagcactacaacaaaag
ccgctgagttcggtcgagcggattcaactgctgaatgatcgattggatgtggtggagtcg
gatgcgctggattggccagcgattgaagctgtagtcgaaaaagcgcagcgtgccgcggat
ttgcaagctttagagcagcttattccgcttactcactgcttaaactggcaaaaagtggcg
gctgccgtcgcgctcacgcgccgttttgcggtgatttccggtgggccgggaaccggcaaa
accaccacagtgaccaagcttctggcggcgctgattagccaaagcatggcgcaaggtaaa
gtgccagagatcaaattgattgctccaaccggtaaagccgcggcacgcttaaccgaatcg
atgggtaaagcggtgagtcagctggcgatagagcctgagatcgccgcggcgatcccaagc
acttccagtaccattcaccgtttgcttggcgcgattccgggcagcgctgagtttcgtcat
catgcacgtaatccactccatcttgatctgttggtggtggatgaagcgtccatggtcgat
ctgcctttgatggtgaaactggtcgaagcgctgcccaagcacgctcggttgattttactt
ggcgataaagatcagttggcctcggtagaagcgggggcggtgctcggtgatatttgtacc
ttcctgaaccaaggttacggtaatgagcagggcgcgcagttggctgaactgacggggttt
gcctctttgcgccaaactgccagtaagacggtgaatccggtggcggattgcttatgcatg
ctgcaaaaaagctaccgttttgatgcacgttctggcattggccaactggcgaaagcgatc
aacagtggatctccggcgcgcgttgaaactgtgtggcagcaatcgttcagcgatattgaa
cattttgcccttagtggcgagcattatcagcaactgctgcaaaccttagtgcaggcttat
cgtccttatctgaatttgctcaatcaatcgactgagcagtttgagtcgacaaagcaaacc
atgctcacactagccaaatcagcactcgatgcgtttagtcgctgccgattattgtgcgcg
ttacgtgaaggcgattttggggtgatggggctgaacactcgcatcgaacgggcgttgaat
gcgcacaagctgattaaaactcaagaagagatctggtatcacgggcgaccgatcatggtc
acgtgtaacgatcatggcttggggctatacaatggtgatatcggtttgtgtatgcgcgat
cgtgacgatgatcagggcagactgaaagtctattttgagctgccggatggcagcattgaa
gccgtgttaccgagccgagtcccgcaacatgaaaccgcgtatgcgatgaccatacataaa
tcgcaaggcagcgaatttgatttaactttgctgattttaccgccggattacagtccgatt
ctgacgcgtgagttagtttacacggggatcacaagggcgaaaaaacagctcaaattgtat
tgcgataacaaggtattgcagcgggcaattaaagtgaaaacccaacgggcgagtggctta
gtggcaaggttggagcagtaa

DBGET integrated database retrieval system