KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2060Help
Entry
VCLMA_A2060       CDS       T01871                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VCLMA_A2060
Enzymes [BR:vcl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VCLMA_A2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2340916..2342262)
Genome map
AA seq 448 aa AA seqDB search
MSLSQAKYLPQEIIRRKRDGEVLTNDEINFFIQGVANNTVSEGQIAAFAMAIFFREMTMP
ERIALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISG
RGLGHTGGTLDKLEAIPGYNITPSNDVFGKVTKQAGVAIIGQTGDLAPADKRVYATRDIT
ATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYQASEELAKSIVAVANGAGTN
TTAILTDMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAKDTV
QAREKLQAVLDNGKAAERFGKMVAGLGGPSDFVENYDKYLAKAEIVRPVYAQQSGVISAM
DTRAIGMAVVGMGGGRRVATDRIDYAVGFDQFIRLGEIADSNKPLAMIHARNEEQWQQAA
NALQNAIKVGGDYVPTPDVYRQIRAQDV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatctcaagcaaagtatttacctcaagaaattatccgcagaaagcgtgatggt
gaagttcttaccaacgatgaaatcaacttcttcattcaaggtgtagcgaataacaccgtc
tctgaaggtcaaatcgctgcttttgcgatggcgatttttttccgtgaaatgactatgcct
gagcgtattgcactgacgtgcgcgatgcgcgattccggtatggtgattgattggagccac
atgaattttgatggtccgattgtggataaacactccacgggcggcgtgggcgatgtgacc
tcactgatgcttggccctatggtggcagcctgtggcggttatgtgccgatgatttctggc
cgcggccttggccacaccggggggacgctcgacaaacttgaagccatccccggctataac
attaccccaagcaatgacgtgtttggcaaagtgaccaaacaagccggcgtggcgatcatc
ggccaaactggcgatctggctccggcggataagcgtgtgtacgcaacgcgtgatattacc
gcgacggtggataacatctcgctgatcaccgcttcaattctttctaagaaactggcggct
ggccttgaatcgctcgtgatggatgtgaaagtgggctctggtgctttcatgccaacttac
caagcgtctgaagagctcgccaaatcgatcgtggcagtggccaacggtgcaggcaccaat
accacggcgattttaactgatatgaaccaagtgctggcgtcctctgctggtaacgcggtg
gaagtgcgtgaagcagtacgtttcctcaccggcgaataccgcaatccgcgtctgctggaa
gtcactatggcgtcgtgtgccgaaatgctggtacttggcaagttagccaaagataccgtg
caagcgcgtgagaaactgcaagcagtgctggataacggcaaagccgccgagcgttttggc
aaaatggtggcaggcctcggtggcccaagcgattttgttgaaaactacgacaagtatctt
gcgaaagctgagattgttcgcccagtttacgctcagcaatctggcgttatttctgcgatg
gatacccgtgccatcggcatggcggtggtcggcatgggcggtggccgccgtgtggcgacc
gatcgtatcgattacgctgtcggctttgatcagtttatccgtctgggtgaaatcgccgac
agcaacaaacctttagcaatgattcatgcccgcaatgaagagcagtggcaacaagctgcc
aatgcactacaaaatgcgattaaagtgggtggtgattacgtaccaacaccggatgtttac
cgtcaaattcgagcacaagacgtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system