KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2112Help
Entry
VCLMA_A2112       CDS       T01871                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VCLMA_A2112
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VCLMA_A2112
Enzymes [BR:vcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     VCLMA_A2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2407198..2408685)
Genome map
AA seq 495 aa AA seqDB search
MNTHSAISELIAPWLELTDPKLAALVITHLELDSRLIKSGDTFVAIQGHAVDGRQFIDKA
IAQGANVVLAEADAQHLNGWVEYRAGVPVIYLAELGQHLSELAGRLYGGHHNQLIGVTGT
NGKTTITQLIAQWLELLGHKAAVMGTTGNGFLNALEPAANTTGNALQIQATLRDLAERGA
QYTALETSSHGLVQGRVKKLHFVAGVFSNLSRDHLDYHGTMEAYAAAKFSLFSEHACQNA
IINVDDAVGAQWVKQLPQAIGVSLVTKPNTAQAIWAREVAYAESGITLNFESSWGEGELH
APLIGEFNACNLLLALATLLSLGFEKSALLATAPKLRPVLGRMELFQREQKAKMVVDYAH
TPDALEKALRALRVHCAGQLWAIVGCGGDRDRGKRPMMAAIAEQFADRVILTDDNPRSES
PQAIVADMVAGLTHPERAHIEHHRFQAASYALQHAGAQDIILLAGKGHEDYQVLANETIH
YSDRETAQQLLELQP
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcattcagcgatctccgaactgatcgcgccatggctagagctgaccgaccct
aagttggccgcgctggtcattactcatcttgaactggatagccgcctgattaaatcgggt
gatacctttgtcgctattcaaggccatgcagtggatggtcgccaatttatcgataaagcc
attgcgcaaggtgccaatgttgtgttggctgaagccgatgctcagcatctcaatgggtgg
gttgagtatcgtgcaggtgtccccgtcatctatttggctgaacttggtcaacatctgtca
gagttggctgggcgtctgtatggcggccaccacaatcaactgattggcgtgacgggcacg
aatggtaaaaccaccatcacccagctgattgctcaatggctcgaattgctcggtcataaa
gctgccgtgatgggcaccacggggaacggttttttaaatgcgcttgaacctgcggccaac
accacaggtaacgcactgcaaattcaggccacactgcgcgatttagccgagcgcggcgcg
caatatacggcgctggaaacctcgtctcatggtttagtgcaagggcgcgtgaaaaagctc
cattttgtggccggtgtcttttccaatttgagccgtgaccatttggattatcacggcacc
atggaggcttacgccgccgcgaaattctctctatttagtgagcatgcctgccaaaacgcg
attattaatgtcgatgatgcggtcggcgcgcaatgggtcaaacaattgccgcaggcgatc
ggggtttccttagtgacgaaaccaaacacagcgcaagccatctgggcgcgcgaagtggca
tacgctgaaagcggtattacgctgaactttgagagttcgtggggagaaggcgaactgcac
gcaccactgattggtgagttcaatgcctgtaacttgttattggcgttggcaaccttgctc
agcttgggttttgagaaaagtgcactgctcgccactgcgccaaagctgcgtcctgtctta
gggcggatggagctgttccaacgtgagcaaaaagccaaaatggtggtcgattatgcgcac
acgccggacgctttagaaaaagcactgcgcgcgttacgtgtgcattgtgcgggtcagtta
tgggcgattgtggggtgtggcggcgatcgtgatcgcggtaaacgtccgatgatggctgcg
attgctgagcaatttgccgatcgcgtgatcctgaccgatgacaacccacgcagtgaatcg
ccgcaagcgattgtagcggatatggtagctggactgactcaccccgagcgcgctcatatc
gaacaccaccgtttccaagccgcgagttatgcgcttcagcatgcaggcgcacaagacatc
atcctgctcgcgggtaaaggacatgaagattatcaggtgctggccaacgaaacgattcac
tactcggatcgtgaaaccgcccaacagttactggagttacaaccatga

DBGET integrated database retrieval system