KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2122Help
Entry
VCLMA_A2122       CDS       T01871                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vcl  Vibrio cholerae LMA3984-4
Brite
Enzymes [BR:vcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VCLMA_A2122
Secretion system [BR:vcl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VCLMA_A2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2423796..2424548)
Genome map
AA seq 250 aa AA seqDB search
MSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKPSDINGLLEV
QTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFKAPN
EKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCSNDP
KAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYLPAP
QLLQRLQATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgcgccgactaacatggctggcatttcctttactgagtatggcattcaac
gtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcagcgctttgcc
aaactcggattgcaagtggaagagattaaaccctctgatatcaatggcttgcttgaagtg
caaacgtctggcggtgtgttgttctcttcgcctgatggtgagcactttatcgcgggtact
ctttatgcgctggatggtaatggtggttatgttgatgtgctggctaaacgccaagcgcca
ctcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaagcgcccaat
gagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtgcgtctgcac
agccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcctacccacgt
caggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttctaacgatccg
aaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgataaagatatc
gcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctcggcattagc
ggtactccagcgattttcttacccaatggtgagatggttggcggctatttgcctgcgcca
caattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system