KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2202Help
Entry
VCLMA_A2202       CDS       T01871                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vcl00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcl00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vcl03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vcl03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vcl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2518722..2519186
Genome map
AA seq 154 aa AA seqDB search
MQETKMPTATFYLISPDSAQATPEGFAQYVLYLTRHFAAQGARIYLQCQDKPHAEQLAER
FWQIEPEQFLAHNLVGEGPKSGTAIEIGYVGVSPSWNRQLAINLADNQTTFARTFTEVVD
FVPCAENAKQLARERYKLYRQAGYQLQTVEIQYP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagaccaagatgcctaccgcaactttttacctgatttccccagattctgctcaa
gcaacgccagaaggcttcgcgcagtacgtgctgtatttgacgcgtcactttgccgcgcaa
ggcgctcgcatttatctgcaatgccaagataaaccacacgccgagcagctagctgagcga
ttttggcaaatcgaacccgaacagtttttagcgcacaatctggtgggtgaaggtcccaaa
tccggtaccgcgattgagataggttatgtgggcgtttccccctcttggaatcgtcaactg
gcaataaatttggcggataatcagacaacctttgcgcgtacctttaccgaggtggtagac
ttcgtgccctgcgcagaaaatgccaagcagctggcgcgcgagcggtataaactctatcga
caagcaggttatcagctgcaaactgttgagattcagtatccataa

DBGET integrated database retrieval system