KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2210Help
Entry
VCLMA_A2210       CDS       T01871                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vcl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2530184..2531113
Genome map
AA seq 309 aa AA seqDB search
MANSLYQKHIISIAELSRAELELIVKTAGQLKAQPNPELIKHKVVASCFFEPSTRTRLSF
ETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVRVISSYVDAFVMRHPQEGAARLASEFS
NGTPVINAGDGSNQHPSQTLLDLYSIYETQGRLDNLDVAFVGDLKYGRTVHSLAQALAKF
DNNRFYFVAPEALAMPDYICEELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESE
YAHIKSAYILTAAHLSDARSNLKVLHPLPRVDEITTDVDKTPHAYYFEQVENGVYAREAL
LALVLNESL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcgctttaccaaaagcacatcatctccattgctgaactctcacgcgctgag
ttggagttgattgtgaaaaccgcaggccaactgaaggcacaaccgaatccagagctgatc
aagcacaaggtcgtggccagctgtttctttgaaccttccacccgcactcgcctctcattc
gagacagcaatccaacgtatcggtggcagcgtgattggctttgataacggcggcaacacg
tcactggcgaagaaaggcgaaaccctagccgattcagtacgcgtcatctcctcttatgtt
gatgcttttgtgatgcgtcatccgcaagaaggtgccgcgcgtttagcttctgagttttct
aatggcacacccgtgataaatgcaggggacggttcaaaccagcacccatcgcaaaccctg
ctcgatctctactcgatttatgaaacccaaggtcgtctcgataacctcgatgtcgcgttt
gtcggcgatttaaaatatggccgcaccgtgcattcactggcgcaagcgctggctaaattt
gataacaaccgcttctactttgtagcacctgaagctctagcgatgccagattacatctgt
gaagagctggatgaagctggtgtcaaataccaagtgttcagcgatatggaaagcgtgatc
ccagagctggatattctgtacatgacacgtgtacagaaagagcgttttgatgagtcggaa
tacgcacacatcaaatcggcctatatcttgacggccgctcacctgagcgatgcgcgcagc
aatctgaaagtgctgcacccactgccacgagtggatgaaatcaccaccgatgtcgataaa
accccacacgcttactatttcgagcaagttgagaacggagtttatgcccgtgaagccttg
ctggctctagttttgaacgaatcgctgtaa

DBGET integrated database retrieval system