KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2360Help
Entry
VCLMA_A2360       CDS       T01871                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCLMA_A2360
   01230 Biosynthesis of amino acids
    VCLMA_A2360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A2360
   00051 Fructose and mannose metabolism
    VCLMA_A2360
   00562 Inositol phosphate metabolism
    VCLMA_A2360
Enzymes [BR:vcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VCLMA_A2360
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VCLMA_A2360
  Exosomal proteins of bladder cancer cells
   VCLMA_A2360
  Exosomal proteins of melanoma cells
   VCLMA_A2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2667884..2668657
Genome map
AA seq 257 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVAGVDVVVAPPAMYLDLAERLIKEGGNK
LILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVAKKFAFLKE
NGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGALVGGASLD
AKGFAAIAKAAAEAKKA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgttgtgatgggtaactggaaactgaatggcagcaaagctatggtcact
gacctgctaaacggcttgaatgcagaacttgaaggtgttgcaggtgttgatgttgtcgtt
gcgccaccagcaatgtatttggatctggctgagcgcctgatcaaagaaggcggcaacaag
ctgatcctgggtgcacaaaacaccgatactcacaacagtggtgcgtacacaggtgatatg
tctcctgcgatgctgaaagatttcggtgcttcgcacatcatcatcggtcactctgagcgt
cgtgattaccacaaagaatcagatgagttcgtcgctaagaaatttgcgttcctgaaagaa
aacggcctaacgccagtcttctgtatcggtgaaactgaagcgcaaaacgaagcgggcgaa
acagaagcggtatgtgctcgccaaatcaacgcagtgatcgatgcttacggcgttgaagca
ctgaacggcgcgatcatcgcttacgaaccaatctgggcaatcggtacgggtaaagccgcg
acagcagatgatgcacagcgtatccacgcgtcaatccgtgcactgatcgcagcgaaagat
gctgcagtagcagagcaagtgatcatccagtacggcggttctgtaaaaccagaaaacgca
gcgtcttactttgcacaaccagacatcgacggtgcgctggttggcggtgcatcactggat
gcgaaaggctttgccgcgatcgccaaagccgcagcagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system