KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2379Help
Entry
VCLMA_A2379       CDS       T01871                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00010  Glycolysis / Gluconeogenesis
vcl00030  Pentose phosphate pathway
vcl00051  Fructose and mannose metabolism
vcl00052  Galactose metabolism
vcl00680  Methane metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
vcl01230  Biosynthesis of amino acids
vcl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A2379
   00030 Pentose phosphate pathway
    VCLMA_A2379
   00051 Fructose and mannose metabolism
    VCLMA_A2379
   00052 Galactose metabolism
    VCLMA_A2379
  Energy metabolism
   00680 Methane metabolism
    VCLMA_A2379
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VCLMA_A2379
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VCLMA_A2379
Protein phosphatases and associated proteins [BR:vcl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VCLMA_A2379
Messenger RNA biogenesis [BR:vcl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VCLMA_A2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEA79568
Position
I:complement(2687434..2688396)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSVSD
VINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGFPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLT
SAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDANKLAKEIESATG
RETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDIIDA
IENMKRPVRTDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgttttgacgagtggtggcgatgccccaggtatgaatgcagct
attcgcggcgtggtgcgtacagcacttggcgcaggtttagaagtgtttggtatttacgac
ggttaccaaggtctgtacgaagatcgtatcaagcaactagaccgttcaagcgtgtctgac
gtgatcaaccgtggcggtacttttttaggctctgcacgcttcccacaatttcgtgaagtt
gaagtgcgcgaaaaagcgattgaaaacctgaaaaagcacggcatcgaagcgctggtcgtg
attggtggtgacggctcttacatgggcgcaaaaaaactgaccgaaatgggtttcccttgt
atcggtctgccaggcacgattgataacgatatcgcgggcaccgactacaccattggctat
ttgactgccctgaacaccgttattgaagcgattgaccgtctgcgtgatacctcttcttca
catcaacgtatctccatcgtagaaatcatgggtcgtcactgtggtgacttgacgctgacc
tctgcgattgcgggtggctgtgaatacatcatcaccccggaaacgggtctgaatatggag
cagctgatttccaatatcaaagatggtattgcgaaaggcaaaaagcacgcgatcattgcg
ttgactgagctgatgatggatgccaacaaactggccaaagagattgaatcggcgacaggc
cgtgagactcgcgcaaccgtattaggccacatccaacggggtggtaaaccaaccgcattt
gaccgtgtactggcatcgcgcatgggtaactacgcagtgcatctattgatggaaggtcac
ggtggtcgttgtgtcggtatccagaaagaacaactggttcaccacgacatcattgatgcg
attgaaaacatgaagcgtcctgtacgcaccgacctgtacaaagtcgctgaagagctgttc
taa

DBGET integrated database retrieval system