KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2398Help
Entry
VCLMA_A2398       CDS       T01871                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vcl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2710593..2711216
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLIAALLEQNPTYAMKVSVSHTTRGMRPGEQDGVHYHFVEKE
HFIELIGKGEFLEYAEVFGNYYGTSRVWIENTLNKGIDVFLDIDWQGARQIRSQMPEAKS
IFILPPSKEELERRLNTRGQDSEAVIAKRMGEAKSEISHYSEYDYVIINDDFDVALMDFK
AIIRAERLKQDKQAAKYSAMLSALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctttatatcgtttctgcacccagtggcgcaggcaaatcaagctta
attgccgccctattggagcaaaacccaacctatgcaatgaaagtctcggtctcacatacc
acacgtggtatgcgccccggcgaacaagatggcgttcattaccattttgtcgagaaagaa
catttcattgagcttatcggcaaaggggaattcctcgaatacgcagaagtgtttggcaac
tattacggcacttctcgggtgtggattgaaaacacactcaataaagggattgatgtgttt
ctcgatatcgactggcaaggtgcgcgtcaaatccgtagccaaatgccagaagcgaaaagc
atctttatcctgccgccttcgaaagaagagctggaacgccgcttaaacacgcgcggtcaa
gacagcgaagcggtgatcgctaaacgcatgggtgaggctaaatctgagatttcgcattac
agcgaatatgattacgtcatcattaatgatgattttgatgtcgcgttaatggatttcaaa
gccatcattcgtgcagaaagattgaagcaagacaagcaagctgctaaatatagcgctatg
ttgtctgctctgttggctgaataa

DBGET integrated database retrieval system