KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2412Help
Entry
VCLMA_A2412       CDS       T01871                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vcl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2726657..2727484
Genome map
AA seq 275 aa AA seqDB search
MSTPQDLSHLLPDVINIARAAGQLILDIYQNKSYEAFTKSDSTPVTSADLAAHKFLCEQL
RELTPDIPILSEEEANIDLATRETWQRYWLVDPLDGTQEFIARSGDFATIIALVENNHPV
MGVVYGPVSGVTYYAYAGKGAWKIPDMAQSLKIQTHKHELPSSSIAIAISRRQDINKITR
RLSSAWNYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQ
LSPLSYNERETLENPNFIVLGDADLPWNEILKIKD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaccacaggatctctcgcacttactgcccgatgtcattaacatcgcgcgagcg
gcagggcaactcatcctcgatatctatcaaaataaatcttatgaagccttcaccaaaagt
gattcaacacccgtcaccagcgccgatttagccgcacataagtttctgtgtgagcagttg
cgcgagctgacccctgatattccgatcctctcagaggaagaagcgaatatcgaccttgcc
actcgcgaaacatggcagcgctattggctggtggatccgctggatggcactcaagagttc
atcgcacgcagcggcgacttcgcgaccatcattgcgctcgtggaaaataaccatccggtg
atgggggtggtgtacggccccgtttctggtgtgacttactacgcttacgcaggcaaaggg
gcgtggaagatccccgatatggcgcagagcctcaaaattcagactcacaaacatgagctg
ccgagcagctcgatcgcgattgccatcagccgtcgccaagacatcaacaaaatcacgcgc
cgtttaagcagtgcttggaattatgacttggtgccactgggctctgcagcactgaaagcc
tgcttagtggcagaaggtgcggtagattgctatctgcgccttggtccaactggcgaatgg
gataccgccgcaacccagtgcattgtcgaagaagcgggtgggcgcattctgagcactcaa
ttatcgcccctctcgtacaatgagcgggaaaccttggaaaacccgaactttatcgtgctt
ggtgatgcggatttaccttggaatgagatcttaaaaatcaaagactag

DBGET integrated database retrieval system