KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2448Help
Entry
VCLMA_A2448       CDS       T01871                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00071  Fatty acid degradation
vcl00280  Valine, leucine and isoleucine degradation
vcl00281  Geraniol degradation
vcl00310  Lysine degradation
vcl00362  Benzoate degradation
vcl00380  Tryptophan metabolism
vcl00410  beta-Alanine metabolism
vcl00640  Propanoate metabolism
vcl00650  Butanoate metabolism
vcl00903  Limonene and pinene degradation
vcl00930  Caprolactam degradation
vcl01040  Biosynthesis of unsaturated fatty acids
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
vcl01212  Fatty acid metabolism
Module
vcl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VCLMA_A2448
   00650 Butanoate metabolism
    VCLMA_A2448
  Lipid metabolism
   00071 Fatty acid degradation
    VCLMA_A2448
   01040 Biosynthesis of unsaturated fatty acids
    VCLMA_A2448
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCLMA_A2448
   00310 Lysine degradation
    VCLMA_A2448
   00380 Tryptophan metabolism
    VCLMA_A2448
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VCLMA_A2448
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VCLMA_A2448
   00281 Geraniol degradation
    VCLMA_A2448
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VCLMA_A2448
   00930 Caprolactam degradation
    VCLMA_A2448
Enzymes [BR:vcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VCLMA_A2448
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VCLMA_A2448
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VCLMA_A2448
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VCLMA_A2448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEA79633
Position
I:2772925..2775096
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
AETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQSFDPQTIIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQA
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagtgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaaaccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttgtcagcgttaaaaggccatacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggcgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagcgttaaaa
gtgggattactggatgctattgtcgatagcgacaaactgatcgattccgcaatcaccacg
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactctaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacatttcatcaagctc
gcaaaatctaccgaggcgcaagcgctggttggtattttcctcaatgatcaatacatcaaa
ggcttagctaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggtggcggcatcgcctatcaatcagctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagaactgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggtttcaaaatggctggcattctggct
tccatcaccccttctctgcattacgctgggattgatcaggcggatgtgattgttgaggcc
gtggtggaaaatccgaaagtaaaagccgcggtactgagcgaagtggaaggattggtcgat
gcagaaacgattctgacctccaatacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccattaaccgagtggttgct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgactgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgcaaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggccctgcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggcggaaggc
ttcccaactcgcatggcgaaaagcggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggtaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaagctttgacccacaaaccattatcgaacgcactatgattccaatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtattccgttacttagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagcc
agtgccctgtaa

DBGET integrated database retrieval system