KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0012Help
Entry
VCLMA_B0012       CDS       T01871                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCLMA_B0012
Enzymes [BR:vcl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VCLMA_B0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:14807..16987
Genome map
AA seq 726 aa AA seqDB search
MNQDNALKQVAAMAKIADRYVSAWGSEAQVEDDTIRRLLASLGYDTSSDEALLQSAEKKH
KKDVVDPVLVVHQGSAIEVPLYLGVSARESEFDWRLQTEQGEVLEGYLQSQIVRDERAEG
GPLVFALPNDLPLGYHTLLIARKRRKAPYEMTLIVTPQACYKQPALAQGKKLWGPSVQLY
TLRTQHNWGMGDFGDLKQLVADIASRGGDFVGLNPIHALFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSAEAQQKVGSPEFQQRLQKVRDAHWVNYSEVAELKMSVLPLLFAEFK
KRHLDKQTDRAHAFLKFVEEGGESLLHQAAFDALHADLHAQDASVWGWPVFPEKYRRFDN
SAVQKFIEDHQDAVHIYMYLQWIADTQIHEVQSLAEEKGMAVGLYRDLAVGVADSGSETW
ADHGNLLQDVSIGAPPDVLGPLGQNWGLPPLNPQALQATAYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGENATKGAYIYYPVKDMLAILALESHRHQCSVIGEDLGTVPDEIVE
LLRDAGVHSYKVFFFETSKEDGGYVSPAHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEEQLQGLFDDRLKSKQGILDSVAWHGYLPDGVGRDATQVPMDSYLSEALQLHVA
AGSSALLSVQLEDWLEMDKPVNIPGTVNEYPNWRRKLSMNLDEIFAREEVNRIAARLTEV
RSKASQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagacaatgcattaaaacaagtcgctgcaatggcaaaaattgccgatcgatat
gtcagcgcgtggggcagtgaagctcaagtggaagacgacacgatccgtcgtcttttggcg
tctcttggctatgacaccagtagcgatgaagccttgctgcaatcggcagagaagaaacac
aaaaaagatgtggttgatccggtactcgttgtacatcaaggttcggcgatcgaagtcccg
ctctaccttggcgtgagtgcgcgcgaaagcgaatttgattggcgcttgcagaccgagcaa
ggcgaggtactggaaggctatctgcaatcacaaattgtacgtgatgaacgtgccgaaggc
ggcccactggtgtttgcgttgccgaatgatctgccgctcggttatcacaccttattgatt
gcccgtaagcgtcgcaaagcaccttacgaaatgaccctgattgtgacgccacaagcttgc
tacaagcaaccagccttggcacaaggcaaaaagctgtggggaccgagcgttcaactttat
accctgcgtacccagcacaactggggcatgggagactttggtgatttgaaacagctcgtg
gcggatattgcatcacgcggcggcgattttgttggcttaaacccgatccatgcgctgttt
ccagccaacccagagggcgcaagcccgtacagcccatcctctcgtcgttggctcaacatt
ctgtacattgatgtgagctcagtacctgaatttgcactcagcgccgaagcgcagcaaaaa
gtgggtagcccagaattccagcagcgcctacaaaaagtgcgtgatgcccattgggtaaac
tacagcgaagtggctgagcttaaaatgagcgtcttacctctgttgtttgccgaatttaaa
aaacgtcatctggataagcagaccgatcgcgcgcacgcgttcttaaagtttgtggaagag
ggcggagaaagcttgctgcatcaagcggcgtttgatgcgctgcatgccgatttacatgca
caagatgcgtcggtgtgggggtggcctgttttcccagagaaatatcgccgttttgataac
agtgctgtacaaaaatttattgaagatcatcaagatgcggtgcacatctacatgtactta
cagtggattgccgatacacagatccacgaagtgcaatcactggccgaagaaaaaggtatg
gcagttggcttataccgcgatctcgccgttggcgtggctgattctggtagtgaaacgtgg
gccgatcacggtaacttgttgcaagatgtcagcattggtgcaccaccagatgtactgggg
cctttggggcaaaactggggcttaccgccactcaacccacaggcgcttcaagccacggcg
tatgacgcgtacatcaaacttctgcgtgctaacatgaagcactgcggagccttgcgtatc
gaccatgtactgggtttgctgcgtttatggtggatcccgaaaggcgaaaacgcgacgaaa
ggcgcgtacatttactacccagtcaaagatatgttggcgattttggcgctcgaatctcac
cgtcaccagtgcagcgtgattggcgaagatctgggaaccgtaccggatgaaattgttgag
ctgctgcgcgatgcgggcgtgcattcgtacaaagtgttcttcttcgaaacgtcgaaggaa
gatggcggttacgtttctccggcgcattacgcagagcaatccatggcggcactctgtact
catgacatgccaaccctgcgcggcttttggcactgtgatgatcttaaaatgggacgtgaa
ataggcctctatcccgatgaagagcagctgcaaggcttgtttgacgatcgcctgaaatcc
aaacagggcattctcgattcagtggcgtggcacggctatttgccggatggcgttgggcgt
gatgcgactcaggttccgatggattcctacttgagcgaagcactgcaactgcatgtagcg
gcaggttcttccgcgttactgagcgtgcagttggaagattggctagagatggataagcca
gtcaatattccgggaacggtcaatgaatacccgaactggcgacgtaagttatcgatgaat
ctggacgagatttttgcgcgtgaagaagtgaaccgcattgcggcacgtctgaccgaagtg
cgcagcaaagccagccaataa

DBGET integrated database retrieval system