KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0013Help
Entry
VCLMA_B0013       CDS       T01871                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCLMA_B0013
Enzymes [BR:vcl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VCLMA_B0013
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCLMA_B0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:17193..19382
Genome map
AA seq 729 aa AA seqDB search
MKITKKPSKVQQFYDQLARAAFADPFSFLGPYIPAEQGALRVWMPGADNVALVVEGQARV
ALDREGEGGFVLKDGRNLRFTHYQLAVDWAGTEQLLDDPYQYHGLYAEYEDLHTPKQMYH
HMGAQFVTLERDGKMVSGVRFLVYAPHAAACSLIGAFNHWDGRRHPMQRLDYGIWGIFIP
GLPEGTQYKFELKGPHGEGLPHKADPWGFYAEQYPSFASVTYDHRRYQWQDTAWQQRPVT
EKRKQALSFYELHVGSWKRGENGEFLNYRELADQLVPYLVEMGYTHVELMPVAEHPFYGS
WGYQPVGLFAPTSRYGSPDDFKYFVDLCHQAGIGVVLDWVPAHFPSDSHGLANFDGTPLF
HDPDPRRGWHQDWNSYIYDLGREHVRRFLVANALYWFEMFHIDGIRVDAVASMLYLDYSR
SHDQWIPNVDGGRENYDAIATFKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGGLGF
GFKWNMGWMHDSLSYIKEDPVHRKYHHNTLTFPLIYAFSENYVLSLSHDEVVYGKRSLMY
KMPGDEWQQTANLRAYLGYMYGQPGKKLNFMGTELGQTAEWDHDGQLQWFLTQFERHSGI
QRLVRDLNHLYQAQTALHQLDCDPRGFEWRLQDNADLSMIAHERMDEAGNRVLVITNFTP
VPQQAFRLGVPKTGKYRLLLNTDAKQYNGSDYPVLQDVSTEAISSEGLDQSLLLSVPPLA
TLFYQWSAK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcacaaaaaaaccatccaaggttcaacaattttatgatcagttggcgcgtgca
gcgtttgctgatcccttttcatttctaggcccttacattcccgctgaacaaggtgcgctg
cgagtgtggatgccgggtgctgacaacgtcgcgttggtggttgaagggcaagctcgtgtg
gcgttagatcgtgaaggcgagggcggctttgtgctgaaagatggccgtaatctgcgtttt
acgcactaccaattggctgtcgattgggcgggtaccgagcagttactcgatgatccgtat
caatatcacggcctctacgctgaatatgaagatctgcatacgccaaagcagatgtatcac
catatgggggcgcagtttgtcaccctagagcgtgatggaaaaatggtctctggcgtacgt
tttctggtgtatgcccctcacgcggcggcgtgcagtttgattggcgcgtttaaccattgg
gatgggcgtcgccatccgatgcagcgtctcgattacggtatttggggaatttttattcct
ggcttgccggaaggcacgcaatacaaatttgagctgaaaggcccacatggagaaggtctg
ccgcataaagcggatccgtggggtttttatgctgagcaatacccttcttttgcttctgtg
acttatgatcatcgtcgttatcagtggcaagatacggcttggcagcagcgccctgtgact
gaaaagcgtaaacaagcgctctcgttttatgagctgcacgttggctcatggaagcgaggc
gaaaacggtgaattcctcaattatcgtgaattggccgatcaattggtgccttatctggtt
gagatgggttatacccatgttgagttaatgcccgtcgctgagcacccattctatggctct
tggggctatcaaccggttggtctgtttgcgcccactagccgttacggctcgccagatgat
ttcaaatattttgtcgatttgtgccaccaagcggggattggtgtggtgctcgattgggtg
cctgcgcacttcccatcagattctcacggtctggccaattttgatggcacgcccttattc
catgatccggatccacgtcgcggttggcatcaagactggaactcttacatctacgatctt
ggtcgcgagcatgtgcgccgtttcttagtcgctaatgcgctgtattggtttgagatgttc
catatcgatggcattcgcgttgatgcggtcgcgtcgatgctctatctcgattattcgcgt
agccatgatcaatggatcccgaatgttgatggtggacgtgaaaactacgatgcgattgct
accttcaaatggatgaacgaggaggtgtacaaacacttcccgaatgcgatgacgattgcc
gaagagtcgaccgcgtttcctggcgtttctgccccgacctttatgggcggcctcgggttt
ggttttaagtggaacatgggctggatgcacgatagcttgtcgtacatcaaagaggatccg
gtgcatcgcaaataccaccacaataccctgactttcccgctgatttacgcgtttagtgaa
aactatgtgctctctttatcacacgatgaagtggtgtatggtaagcgctcgcttatgtac
aagatgccgggtgatgagtggcagcaaaccgccaacttacgcgcctacttgggttatatg
tatggtcagccgggcaaaaaactcaactttatgggtaccgagttaggacagactgcggag
tgggatcacgatggtcagttgcagtggttcttaacgcaatttgagcgccattcggggatc
cagcgtttggtgcgtgatttgaaccatctgtaccaagcccaaacggcgttgcatcagctt
gattgcgatccgcgcggcttcgaatggcgcttacaagataatgccgatctcagcatgatc
gcccatgaacggatggatgaagccggtaatcgtgtgttagtgatcaccaacttcacgcct
gttccacagcaggcatttcgcttaggtgttcctaaaacagggaagtaccgcttgttgctc
aataccgatgccaagcagtacaacggcagtgattatccggtattgcaggatgtgagtacg
gaagcgatcagcagtgaaggtttggatcaatcgctgctattgagtgtgccgccgctcgcg
acgctattttatcaatggagtgcgaagtag

DBGET integrated database retrieval system