KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0116Help
Entry
VCLMA_B0116       CDS       T01871                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VCLMA_B0116
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VCLMA_B0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:143333..144253
Genome map
AA seq 306 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARMQADVGFIAC
VGDDSFGINIRESFKLDGINTAGVKLQPNCPTGIAMIQVSDSGENSICISAEANAKLTAA
AIEPDLAAIRDASYLLMQLETPLDGILKAAQEAKAAKTNVILNPAPARELPDELLKCVDL
ITPNETEAEVLTGITVYDDSSAQQAADALHCKGIEIVIITLGSKGVWLSQNGRGQRIPGF
VVKATDTTAAGDTFNGALVTGLLQEMPLESAIKFAHAAAAISVTRFGAQTSIPTRAEVEA
FLAEHS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttggtggttctgggtagcgtcaatgcagaccatgtgctgcaagtgccttca
tttcctcgccccggagaaaccctacacgggcgcaattatcaagtcattccgggcggaaaa
ggggcaaaccaagcggttgccgccgcgcgtatgcaagcggatgtgggtttcattgcctgt
gttggcgatgattcgtttggcattaatattcgtgaaagttttaagttagatggcattaat
acggcgggcgtgaaactgcaacccaattgcccaaccggcattgcgatgattcaagtctcc
gacagtggtgagaacagtatctgcatttctgcagaagctaatgccaagttgactgctgcc
gcgattgagcctgatctcgcggcgattcgggatgcaagttatctgctgatgcaactagaa
acgccgcttgatggcattttaaaagcggcgcaagaagccaaagcggccaaaaccaatgtg
attcttaaccctgcaccagcccgtgaactgcctgatgagttgctgaagtgtgtagatttg
atcacgccgaatgaaaccgaagcggaagtgctcaccggaattacggtttatgatgattct
agtgcgcagcaagcggcggacgctttacactgtaaaggcatcgagattgtgattattacc
cttggttcaaagggtgtgtggctgagccaaaatggtcgcgggcaacgaattcccggtttt
gtggtgaaagccacggacaccaccgccgcaggtgatacctttaacggtgcattggtgact
ggcttgttgcaagaaatgcctctagaatcagctattaagtttgcccatgccgctgccgca
atttcggtaacacgctttggtgcgcaaacctcgattcccactcgtgcggaagttgaggcc
tttttagcagaacactcatag

DBGET integrated database retrieval system