KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0409Help
Entry
VCLMA_B0409       CDS       T01871                                 

Definition
GTP cyclohydrolase I type 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(446697..447350)
Genome map
AA seq 217 aa AA seqDB search
MSGLSESAKLVKDALERRGLETPMQPNLATPAEKKEKIEQHMREILNLLGLDLTDDSLEE
TPQRIAKMYVDEIFSGLDYANFPKITVIENKMKVSEMVKVKDITLTSTCEHHLVTIDGTA
AVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYC
VKSRGVMDATSVTTTTALGGIFKSNPATRAEFLHGLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtcttagcgaatccgcgaagttggtgaaagatgcgctagagcgccgagggttg
gaaacaccaatgcagcccaacttggcgacaccagcagagaaaaaggaaaaaatcgaacag
catatgcgtgagatcctcaacctgctcggactggacttaacggatgacagtttggaagaa
accccacaacgcatcgctaagatgtatgtggatgagatcttctcagggttggattatgcc
aacttccccaaaatcactgttatcgaaaataagatgaaagtgagtgagatggttaaagtg
aaagacatcacgctgaccagcacgtgtgaacaccacttagtcaccatcgatggcacggca
gcggtggcgtacatcccgcgcggcaaaatcatcggcttatcgaaaattaaccgtattgtg
cgcttttttgcccagcgtccgcaggtgcaagagcgtatgacgcagcagatcttagttgcg
ctgcaaacgttgcttgagtcggatgatgtggcagtcaccatcgatgcgactcactattgc
gtgaaatctcgcggcgtgatggacgcgaccagcgtcaccacaacaaccgctttgggtggg
atttttaaatctaaccctgcgacgcgtgcggaattcctacacggtttgcgttaa

DBGET integrated database retrieval system