KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0528Help
Entry
VCLMA_B0528       CDS       T01871                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VCLMA_B0528
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VCLMA_B0528
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCLMA_B0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(576938..578455)
Genome map
AA seq 505 aa AA seqDB search
MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTAAICEELKARG
LESYIRDNTGLVLDPYFSGTKIKWILDNVEGAREQAEAGQLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINTLQWDEKILAEFNIPLSMMPEVKKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVQAGQAKNTYGTGCFLLMNTGQEKVTSNNGLLTTLACGPRGEPA
YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDRSFKPHHDEEKR
QRRYKGWKRAVKCAQAWAVLHNEEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacgtcgtcgctctcgatcaaggtactaccagctctcgcgccgtg
gtgttagaccatgatgcgaatatcgtgagcgtttctcagcgtgagtttacccaaatctac
ccgcaagccgggtgggtggaacacgatccaatggaaatctacgctacgcaaagctcaaca
ttggttgaagcgctaggtaaagcaggcattcgcagtgatgaagttgcggccatcggtatt
accaaccaacgtgaaaccacggtagtgtggaataaagagacgggtaagcctgtctacaac
gcgattgtttggcaatgtcgccgtactgctgccatttgtgaagagctgaaagcgcgcggt
ttagaaagttacattcgcgacaataccggtttggtgctcgacccttacttctcaggtacc
aaaattaaatggattctggacaatgtagaaggcgcacgcgagcaagctgaagcaggacaa
ctgctgtttggtacggttgatacatggctagtgtggaaaatgactcaaggccgtgtgcat
gtgaccgattacaccaacgcatcccgtactatgctgttcaacatcaacaccttgcagtgg
gatgaaaagatcctcgccgaatttaatatcccgctctccatgatgccggaagtgaaaaaa
tcgtctgaagtgtacgggcaaaccaacatcggtggtaaaggcggtacgcgtattccaatc
gcggggattgccggtgaccagcaagcggcattgtacggccaaatgtgtgtacaagcggga
caagcgaaaaacacctacggtacgggttgcttcttgctgatgaacactggacaggaaaaa
gtgacctcgaacaacggcttgctgaccacgctagcgtgtggcccacgcggtgaaccggct
tatgcactggaaggggcggtgtttatgggcggtgcatccattcaatggctgcgtgatgag
ctgaaactgatttccgatgctcgtgactctgagtacttcgccaccaaagtggatacctcc
aatggggtgtatgtggtgccagcctttacgggtttaggcgctccgtactgggatgcgtat
gcgcgtggcacaattgttggtttaacgcgtggcgtgaactcaaaccacattattcgcgca
acgctggaaagtatcgcttaccaaacgcgtgatgtgttggatgcgatgcaagccgattct
ggcatcaagctttctgcgctgcgtgtcgatggtggtgcggttgccaacaacttcctgatg
cagttccaagcagatgtattggataccgaagtgcatcgtccgaaagtcacggaagtcacc
gcgttaggtgccgcttatctagccggtctggccgttggtttctgggatggtttggaagag
ctgcaaggcaaagcggaaatcgatcgcagctttaaaccgcatcatgatgaagagaagcgt
caacgccgttataaaggttggaagcgtgcggtgaaatgtgcccaagcgtgggcagtactg
cacaacgaagaagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system