KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0565Help
Entry
VCLMA_B0565       CDS       T01871                                 

Definition
Arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VCLMA_B0565
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VCLMA_B0565
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VCLMA_B0565
Lipid biosynthesis proteins [BR:vcl01004]
 Fatty acid synthase
  Component type
   VCLMA_B0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:615689..616288
Genome map
AA seq 199 aa AA seqDB search
MTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSLLADELVEQGQTVTVVN
GSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQTVTHNLTTMIEQIQAQN
AKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQVILKPEWMMADGLHPK
PEAQPWIAKFVAEHLAAHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgactcgactactttcctttttgtttgttgttctcttttctgctgcagccagcagtaaa
acgttattggtactcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagct
tggccaagtttactggccgacgagctagtggaacagggtcaaaccgttaccgtcgttaac
gggagcatttctggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagc
caacatcagcccgataccgtactgatagaattaggggccaacgacggtttacgtggtttc
ccaccgcaaacggtcactcataacctcaccaccatgattgaacagatccaagctcaaaac
gcaaaagtcatcttaatgcagatccgtatcccacctaactatggcaaacggtacagcgat
gcgttttaccagatctatcctagcctagctgagcagttttctatcccgcttatcccgttc
tttcttgagcaagtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaa
cctgaagcgcagccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system