KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0591Help
Entry
VCLMA_B0591       CDS       T01871                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VCLMA_B0591
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VCLMA_B0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(644968..645897)
Genome map
AA seq 309 aa AA seqDB search
MNDLFTKTDYSLYSNAMTFVRRPYVRNPVDTNADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFKMINVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
ALGGDHFITLPILRAYAKHYGEMALIHFDAHTDTYANGSAYDHGTMFYHAPKEGLISAKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVEEIVAQIRHIVGDKPVYLTFDIDCLDPAFA
PGTGTPVCGGLSSDKILKIIRALKGINLIGMDVVEVSPPYDQSDLTSLAGATIALELLYV
WASNKKDEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactctactcaaacgcgatgacgtttgtc
cgtcgtccctatgtgcgtaacccagtagatactaatgctgatgtcgtggtacttggcgtg
cctttggatatggcgacgtccggtcgtccgggtgctcgtatggggcctgacgcgattcgt
cgtgcttcggttaacctcgcttgggaaggtaagaaattcccttgggatttcaacctgttc
aaaatgatcaacgtgattgatgcgggcgatttggtttttgattgcggtgatgctgaagat
ttcacttaccgcctagaagccgcaaccagcgaaatcctgaaaagtggcaaaaccatgctg
gcactgggtggtgaccacttcatcactctgccaatcctgcgtgcttacgctaagcactac
ggtgaaatggcgctgatccactttgatgcacacacggacacttacgcgaacggcagtgcg
tatgaccatggcaccatgttctaccatgcgccaaaagaaggtctgatctcggctaagcac
tcggtgcaagtgggtattcgtacggaatacaaacaagaaggccacggcttcaacgtgatt
aacgcgatgcaagccaacgacatgtctgtcgaagagattgtggcgcaaattcgccacatc
gtgggtgacaagccggtttacctgactttcgacattgactgtctggatcctgctttcgca
ccgggtacgggtaccccagtttgtggcggtttgagctcagacaagatcctgaaaatcatc
cgcgcgctgaaaggcattaacctgatcggtatggatgtggtagaagtgtcacctccttac
gatcaaagcgacctgacttcactggcgggtgcgacgatcgctctggaactgctctacgtt
tgggcatccaacaagaaagatgaagagtaa

DBGET integrated database retrieval system