KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0714Help
Entry
VCLMA_B0714       CDS       T01871                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
vcl  Vibrio cholerae LMA3984-4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:781942..782958
Genome map
AA seq 338 aa AA seqDB search
MTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGLC
PPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKDL
ERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDAL
FDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKRL
QSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSITA
SFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtacctttaatg
atgaaacatcatgtcgcggccacccccgtgaattatgccttgtggtatacctacgtcgac
caagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctttgc
ccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaaccaat
attaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatgagt
gatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggattta
gagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgcttg
gtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaacgcg
gcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgctctg
ttcgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacgctg
atccatgctggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagccctt
aatgacaactatggccacctgtttggtgaccaaatcatccgtgcgatcgccaaacgtctt
cagagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgcactg
attgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgttca
atagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattaccgct
tcgtttggtgtagtagaaaagattgaaggcgactctttggagtctctcatcggtcgagcg
gatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system