KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0714Help
Entry
VCLMA_B0714       CDS       T01871                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vcl  Vibrio cholerae LMA3984-4
Brite
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VCLMA_B0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:781942..782958
Genome map
AA seq 338 aa AA seqDB search
MTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGLC
PPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKDL
ERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDAL
FDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKRL
QSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSITA
SFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtacctttaatg
atgaaacatcatgtcgcggccacccccgtgaattatgccttgtggtatacctacgtcgac
caagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctttgc
ccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaaccaat
attaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatgagt
gatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggattta
gagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgcttg
gtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaacgcg
gcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgctctg
ttcgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacgctg
atccatgctggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagccctt
aatgacaactatggccacctgtttggtgaccaaatcatccgtgcgatcgccaaacgtctt
cagagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgcactg
attgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgttca
atagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattaccgct
tcgtttggtgtagtagaaaagattgaaggcgactctttggagtctctcatcggtcgagcg
gatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system