KEGG   Vibrio cholerae LMA3984-4: VCLMA_B0715Help
Entry
VCLMA_B0715       CDS       T01871                                 

Definition
Malate synthase-like protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCLMA_B0715
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCLMA_B0715
   00630 Glyoxylate and dicarboxylate metabolism
    VCLMA_B0715
Enzymes [BR:vcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VCLMA_B0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(783078..783656)
Genome map
AA seq 192 aa AA seqDB search
MNMLTFDKTEIQHQNKPFIAEAVFAVETVAANQQREKQTKAKQLLDRLFPLENGTHQDVT
AYVIDYNHLLAYFQDGRHSGLKYPKQFVAFNGSKENPSHLLFRDGQGSHVEMTLGCQRGT
GCIELREIADIQLETCTVLNHSNDHAQPSTTIRHWVSLIKGDEQGRPQARIEEKEYTARN
GDEYFLGDCFSH
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctgacgtttgataaaacagaaatccaacaccaaaacaaaccctttatcgct
gaagctgtgttcgccgtagaaacggtcgccgccaatcaacagcgtgaaaaacaaaccaaa
gccaaacagttattggatcgcctgtttccgcttgaaaatggtactcaccaagatgtgacc
gcatacgtgatagattacaatcacctgctcgcttactttcaagatggccgtcatagtggc
ttgaaatacccaaaacagtttgtggcgtttaatggcagtaaagaaaatccaagccatctt
ctgtttcgtgatgggcaaggtagtcatgttgaaatgacattaggttgccagcgcggcacg
ggttgcattgagttacgagaaatcgcagatattcagttagaaacgtgcacagtactcaat
cattccaatgaccacgcacaaccaagcaccactattcgccactgggtaagtttgatcaaa
ggcgatgaacaaggtcgaccacaagctcgtattgaagagaaagagtatacggctcgaaat
ggtgacgaatatttcctcggagactgtttttcacattaa

DBGET integrated database retrieval system