KEGG   Vibrio cholerae M66-2: VCM66_0089Help
Entry
VCM66_0089        CDS       T00891                                 

Gene name
yhjA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vcm  Vibrio cholerae M66-2
Brite
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VCM66_0089 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:86539..87540
Genome map
AA seq 333 aa AA seqDB search
MKVVLTSLSLAISLSLAGYAFAASPRNEPVSPILPAQEIHIGKAELGKKLYFDPRLSKSG
FISCNSCHNLSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGG
PIANPGEMAFTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSR
FDQWLMGDDSAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGL
SAVTGADADRFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKI
VAFLHTLTGEQPSFALPILPPSNDNTPKPQPFD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgttcttacctcgctgagcttagcgatatccctctccctcgctgggtatgct
tttgcggcatcgccaagaaacgaacctgtttcccccattttacctgcgcaggaaatccac
attggaaaagccgagttgggtaaaaaactgtactttgatccgcgcttatccaagtcaggg
tttatctcgtgtaactcatgccataacttgagcatgggcggcagtgataacttaaaaacg
tccatcggtcataactggcaacaaggtccaatcaactcaccgactgtgctcaattccagt
ttgaatatcgcccaattttgggatggtcgagcggccgatctgaaagagcaggcgggtggg
ccgattgccaatccgggtgaaatggcttttacgcatacgttagccattgatgtgttgcaa
tcaatcccagcttacgtgagtgagtttcgtctagtgtttggtaagccaaccctcgatatc
gatcaagtgactgaagcgattgcggagtttgaaaagaccttagtgaccccatactcacgt
tttgaccaatggttaatgggggatgatagcgcgataacggctcaagagctggcaggctat
gaattgtttaaaaactcgggctgcgtggcttgtcataacggcagtgcgttaggtggcaat
tcgttccaaaaaatgggtttgattgaaccgtatcaaaccaacaataaagtcgaaggactc
agtgcggtaaccggcgctgacgccgatcgctttaaatttaaagtcccgacactgcgcaat
gtggcgttaacgtatccctacttccatgacggagaagcggccacgcttaaagacgctgtg
gatatcatggggcgtttacagctagggcgtaaatttaccgatgatgaaaacggtaagata
gtggctttcttgcataccttaacaggagagcaaccaagctttgctttacccattttaccg
ccatccaacgataatacacctaagcctcagccttttgattag

DBGET integrated database retrieval system