KEGG   Vibrio cholerae M66-2: VCM66_0380Help
Entry
VCM66_0380        CDS       T00891                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VCM66_0380 (galU)
   00052 Galactose metabolism
    VCM66_0380 (galU)
   00500 Starch and sucrose metabolism
    VCM66_0380 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VCM66_0380 (galU)
Enzymes [BR:vcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VCM66_0380 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(405360..406235)
Genome map
AA seq 291 aa AA seqDB search
MMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGK
HSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELV
GDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKD
DLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKA
GCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaagaagtgtctatttccggcagctggctacggtacccgattcctaccagcg
actaagtcgatgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggt
gttgatgaagcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaag
cattcgatcatggatcactttgacatgaactacgagttagagcaccaaatccgcggtacg
aataaagaagagctattgggtgatatccgtaaaatcatcgaaagcgctaactttactttt
attcgccaacgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtc
ggtgatgagccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggc
gtactggcacagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaa
gaggttccagaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagac
gatctgttccgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaac
ctcgccatcattggccgttatatcctcacgccagatatttttgatctgattgagcagacc
gagccgggcaaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcg
ggttgtgtactggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggc
tatatcgaagccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtg
gagttggctaaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system