KEGG   Vibrio cholerae M66-2: VCM66_0425Help
Entry
VCM66_0425        CDS       T00891                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vcm  Vibrio cholerae M66-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vcm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:454525..455022
Genome map
AA seq 165 aa AA seqDB search
MMISMIAAMADQRIIGKDNQMPWHLPADFAWFKRCTLGKPVVMGRKTYQSIGRPLPGRHN
IVISRDASLQIEGVDVVTSIEAALAKAGEVDEVMIIGGGSLYAACLPMAHKLYITEIHAK
LDGDTQFPEWGSDWLERSREHYPADEKNAYGMDFVIFERQYPLPT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagtatgattgccgcgatggcagaccagcgcattattggtaaagataaccag
atgccttggcatctaccggctgatttcgcgtggttcaaacgctgtacattaggtaagcct
gtagtgatggggcgtaaaacctaccaatcgatcggacgtcctttaccggggcggcacaat
attgtgatctcccgtgatgcgagtttgcagattgagggggtggatgtggtgacctccatt
gaggcggcgctggcgaaagcgggtgaggtcgacgaggtgatgatcatcggaggtggtagc
ttgtatgcggcctgtttgccgatggcccataaactgtatattaccgagatccatgcaaaa
ttggatggtgatactcagtttcctgaatgggggagtgattggctagagcgctctcgtgag
cattatcctgccgatgaaaaaaatgcctacgggatggattttgtgatttttgaacgccaa
tatccccttcctacttga

DBGET integrated database retrieval system