KEGG   Vibrio cholerae M66-2: VCM66_0439Help
Entry
VCM66_0439        CDS       T00891                                 

Definition
(GenBank) glutaminase family protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00220  Arginine biosynthesis
vcm00250  Alanine, aspartate and glutamate metabolism
vcm00471  D-Glutamine and D-glutamate metabolism
vcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VCM66_0439
   00220 Arginine biosynthesis
    VCM66_0439
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VCM66_0439
Enzymes [BR:vcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     VCM66_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACP04764
UniProt: C3LRX1
Position
I:470054..471004
Genome map
AA seq 316 aa AA seqDB search
MRQTNNKESTMKPTADILASIIEEVRPLTSKGIVADYIPALAKVPSDKLGIAVFTNQGEV
ITAGDAQEGFSIQSISKVLSLTLAMGLYQPDELWSRVGKEPSGQAFNSLIQLEMEQGIPR
NPFINAGAIVVCDMLQSRLSAPRQRLLEFVRQLSGEPQIAYDKVVAASEMMHSDRNAAIA
YLMRSFGNFHNEVIPVLHNYFHACALKMSCVELAKTFSYLANKGVSVVTGETVITPTQSK
QTNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTIAVWSPALDQSGNSLAG
TRALELLAQRIGRSIF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaaactaataataaagagtcaaccatgaagccaacagcagacattttagccagc
attattgaagaagttcgcccgctcaccagtaaaggcatcgtcgccgattacatccccgca
ctagcgaaagtaccgagtgataaattgggtattgctgtgtttaccaaccaaggggaagtc
atcacggcaggcgatgcacaggaagggttttcgattcagtcgatatccaaagtgctgagc
ttgacgctcgcgatgggcttgtatcagccagatgaactgtggagccgcgtgggtaaagag
ccttcaggacaagcatttaactcattgattcagcttgaaatggagcagggaatcccacgt
aatccatttatcaatgccggcgcgattgtggtgtgcgacatgctgcaaagtcgcctctct
gcacctcgtcagcgtctgttggagtttgtacgccagctcagcggcgagccgcaaattgct
tatgacaaagtcgtggctgcttcggagatgatgcacagtgatcgcaacgcggcgattgcg
tatttgatgcgttcatttggcaatttccacaatgaggttattccggtactgcacaactat
tttcacgcctgcgcattgaaaatgagctgtgttgagctggcgaaaaccttcagctatctg
gccaacaaaggtgtttctgtggtgacgggcgaaacggtgatcacgccaacccaaagcaaa
caaaccaatgccttactcgccacgtgcggcttgtatgatggggcaggagagtttgcctat
cgagttggtatgcccggaaaatcaggtgttggcggtgggattattgctgtggtgccggga
gaaatgacgattgcagtgtggtcccccgcgctggatcaatcgggtaactcgctcgcgggg
actcgcgcgttagagttactcgcgcagcggattggtcgctcaattttctaa

DBGET integrated database retrieval system