KEGG   Vibrio cholerae M66-2: VCM66_0453Help
Entry
VCM66_0453        CDS       T00891                                 

Gene name
gshB
Definition
glutathione synthetase (EC:6.3.2.3)
Orthology
K01920  
glutathione synthase [EC:6.3.2.3]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VCM66_0453 (gshB)
Enzymes [BR:vcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     VCM66_0453 (gshB)
Exosome [BR:vcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCM66_0453 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(481667..482623)
Genome map
AA seq 318 aa AA seqDB search
MIKLGIVMDPIASINIKKDSSFAMMLEAQRRGYEIHYMEMNDLHLEQGVALADTKVVELK
EDPSGWYQFKSEQTIALSELDAILMRKDPPFDTEYIYATYILERAEDEGVLVVNKPQSLR
DCNEKLFTAWFPELTPITMVTRKAEKIKAFREQHGDVILKPLDGMGGASIFRVKEGDPNL
SVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEPMPYCLARIPAKGETRGNLAAGG
RGEPRPLSETDKKIALAVAPTLKEKGLLFVGLDVIGDKLTEINVTSPTCIREIEAAYDIS
ITGKLMDAIERRLKATAM
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactcggtattgtgatggaccctatcgcgtccattaacatcaaaaaagattcc
agctttgccatgatgcttgaagcgcagcgtcgcggttatgaaatccattatatggagatg
aatgatctacacttagagcaaggtgtagcactggccgatactaaagttgtcgagctgaaa
gaagatccgagcggttggtaccaattcaaatctgagcaaaccatcgcactttctgaattg
gatgcgattttaatgcgtaaggatccgccgttcgacaccgaatacatctacgcaacctac
attttggagcgcgcggaagatgaaggcgtattagtggtgaacaaaccacaaagcctgcgc
gattgtaatgaaaaactgttcaccgcttggttcccagagctgacgccgatcactatggtg
acgcgcaaagccgagaagattaaagccttccgtgaacagcatggggatgtgattctaaaa
cccctcgacggtatgggcggtgcttcgattttccgcgttaaagagggcgatccaaacctc
tcagtgatcatcgaaaccttaaccaaccacggccagaattactgcatggcgcagaccttt
gtgccagatatcagcaacggtgataaacgcattttggtggtcgatggtgaacctatgcct
tactgcttggcgcgtatccccgccaaaggggaaacccgcggtaacttggcggctggcggt
cgtggtgagcctcgcccactgagtgaaaccgataagaaaattgccctagcggtcgcaccg
actctcaaagagaaagggctgctgtttgtaggcttagatgtcattggcgataaactgacc
gaaattaacgtcaccagcccaacctgcattcgagagattgaagctgcgtacgatatttca
atcacaggcaagctgatggatgccattgagcgtcgcttaaaagcgacggcgatgtga

DBGET integrated database retrieval system