KEGG   Vibrio cholerae M66-2: VCM66_0614Help
Entry
VCM66_0614        CDS       T00891                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vcm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vcm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vcm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vcm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:658215..658622
Genome map
AA seq 135 aa AA seqDB search
MLSSSHYLSAMDIQQWELIHPERLAGFQPRTQTLDHDCRLLLVANQPPQGAEILLLERIL
KSFQLELSMVRYIAPIQLSQLAYTGLEWIWFAGCDPLSHQAQKQLHSPRLSDIDGNTQYR
RALWQQICAHQGIAS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttcttcacactatttgtccgcgatggacattcaacaatgggaattgatccat
ccagagcgtttggccggatttcagccgcgcacacaaacgctggatcacgattgccgactc
ttgttggtggccaatcaaccgccacaaggcgcggaaattctgttgctggagagaattctc
aaaagctttcagcttgagctgtcgatggttcgctacatcgcaccgattcagctcagtcaa
cttgcctatactggactcgagtggatctggtttgcgggctgcgatcccttatctcatcag
gctcaaaaacagctgcattcaccgcggttgagtgacattgatggcaatactcaataccgc
cgcgcgttgtggcagcaaatttgcgctcatcaaggaatcgcatcatga

DBGET integrated database retrieval system