KEGG   Vibrio cholerae M66-2: VCM66_0650Help
Entry
VCM66_0650        CDS       T00891                                 

Gene name
exoII
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vcm  Vibrio cholerae M66-2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VCM66_0650 (exoII)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VCM66_0650 (exoII)
Enzymes [BR:vcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VCM66_0650 (exoII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:697322..698314
Genome map
AA seq 330 aa AA seqDB search
MGPLWLDVAGYELSAEDREILQHPTVGGVILFGRNYHDNQQLLALNKAIRQAAKRPILIG
VDQEGGRVQRFREGFSRIPPAQYYARAENGVELAEQGGWLMAAELIAHDVDLSFAPVLDM
GFACKAIGNRAFGEDVQTVLKHSSAFLRGMKAVGMATTGKHFPGHGAVIADSHLETPYDE
RETIAQDMAIFRAQIEAGVLDAMMPAHVVYPHYDAQPASGSSYWLKQVLREELGFKGIVF
SDDLSMEGAAVMGGPVERSHQALVAGCDMILICNKREAAVEVLDNLPIMEVPQAEALLKK
QQFSYSELKRLERWQQASANMQRLIEQFSE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctttggttggatgtggccggttacgaactgagtgccgaagatcgcgaaatt
ctgcagcaccctacagtgggtggtgtgattctgtttggtcgcaactatcacgataaccag
caattgctggcactcaataaagcgatccgtcaagcggcgaaaagaccgattttgattggt
gtcgatcaagaaggtggccgcgtgcagcgtttccgtgaaggcttttctcgcattccccct
gcgcagtattacgcgcgtgctgagaatggcgttgagcttgctgagcagggcggttggttg
atggcggcagagctgattgcacacgatgttgatttaagttttgcgcctgtgctcgatatg
ggctttgcgtgtaaagcgattggcaaccgtgcttttggtgaagatgttcaaactgtactt
aagcacagcagtgcttttctgcgcggcatgaaagccgtcggcatggcgaccacaggcaaa
catttccccggccatggcgcggtgattgccgattcgcatttagagaccccttacgatgag
cgggagacgattgcgcaagatatggcgattttccgtgcgcaaattgaggctggagtgcta
gatgccatgatgccagcgcatgtggtgtatccgcattacgatgctcaacctgcgagcggt
tcgagctactggctaaaacaagtgttacgtgaagaactcggctttaaaggcatcgtattt
tcggatgatttgagcatggaaggcgcagccgtaatgggggggccagttgagcgctcccat
caagctttggtcgccggttgtgacatgattttgatctgtaacaagcgtgaggcggcggtc
gaagtgctggataaccttccgatcatggaagtaccacaagctgaagcactgctgaaaaag
cagcaatttagctacagtgagctgaagcgtttagagcgttggcagcaagcgtcagccaat
atgcagcgcttaatcgagcagttctccgaatag

DBGET integrated database retrieval system