KEGG   Vibrio cholerae M66-2: VCM66_0692Help
Entry
VCM66_0692        CDS       T00891                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCM66_0692 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCM66_0692 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    VCM66_0692 (aceB)
Enzymes [BR:vcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VCM66_0692 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:746399..748069
Genome map
AA seq 556 aa AA seqDB search
MFLVSVSRKEFMSINTAELTQHTTETKITQGKLAVVGTLSPEHQAIFPVEAQTFLQQLCE
RFAPRVDELLTLREQKQTLIDQGQLPDFLPETKDIREGSWKILGIPDDLQDRRVEITGPT
DRKMVINALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAILGSISYTNPDNGKRYELN
ANPAVLICRVRGLHLKEKHVTYNGLAIPGSLFDFALYFYNNHRALLKKGSGPYFYLPKLQ
AYQEAQWWSDVFHFTEDYFGLDTGTIKATVLIETLPAVFQMDEILFSLKEHIVGLNCGRW
DYIFSYIKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAK
DPALNEQVLQKIRGDKMLEATNGHDGTWVAHPGLADTAMAVFNEVLGERKNQLNVSRMAD
APITAAELLAPCDGSRSEHGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRAS
IWQWIQHGKTLDNGQVVTNELFRDYLKQEIEVVKSEVGESRFAQGRFTEAAELMERLTTS
QELPNFLTIPGYDYLP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggtgagtgtttcaaggaaggaatttatgtcaatcaatactgctgaattaacc
caacacaccacggaaaccaaaatcacccaaggcaagcttgctgttgtgggtaccctttca
cccgaacatcaagcgattttccctgtcgaagcccaaacttttttacagcaactctgtgag
cgctttgcgccgcgagtggatgaattactgaccttgcgtgaacaaaaacaaacgcttatc
gaccaaggccagctacctgattttcttcctgaaaccaaagatatccgtgaaggaagctgg
aagattctcggcattccagacgatctgcaagatcgtcgcgtagagatcacggggccaacc
gatcgcaaaatggtgattaatgcactgaacgcgaatgtgaaagtctttatggctgacttt
gaagattcgatgtcgcccgcgtgggataaggtgttggatgggcagatcaacctgcgtgat
gcgattctgggcagcataagctataccaacccagacaatggcaagcgttatgagctcaat
gccaacccagcggtgctcatctgccgcgtgcgcggtctgcatctcaaagaaaaacatgtc
acctacaacggcttggcgattcccggttcactgttcgattttgcgctctatttttacaac
aaccatcgcgcactattgaaaaaaggcagtggcccttatttctacctacctaagctgcaa
gcttatcaagaggcgcagtggtggagtgacgtgttccatttcacggaagattattttggc
ttagacacaggcaccatcaaagcaacggtgttgattgaaactctgcctgcggtatttcag
atggatgagatcctcttctcactcaaagagcacattgtcggtctgaactgtggacgctgg
gattatattttcagctacatcaaaaccttgaaaaagcatcccgaccgcgtattgccggat
cgccaagtggtgaccatggataagcctttcctcaatgcgtattcccgtttgttgatttac
acctgtcataaacgcggcgcgtttgcgatgggcgggatggcggcgtttattccagccaaa
gatcctgcgctcaatgaacaagtgctacaaaaaattcgcggcgacaaaatgcttgaagcg
accaatggccacgatggcacttgggttgctcaccccggtttagcggataccgcgatggcg
gtgtttaacgaagtgcttggtgagcgcaaaaaccaactcaatgtgagccggatggccgat
gctccgataaccgcggccgagctattggcaccttgcgatggatcacgctctgagcatggc
atgcgccacaacattcgcgttgcgttgcaatacatcgaagcatggatttctggtaacggt
tgtgtgccgatctacggcttgatggaagatgcggcgacagcggagatttcacgcgcttcg
atttggcaatggatccaacacggcaaaacgttagataacgggcaagtggtcactaacgaa
ctgtttcgcgactacctcaaacaagagattgaggtggtgaaaagcgaagtgggtgagtcc
cgttttgcacaagggcgttttactgaagcggccgaattgatggagcgcttaacgaccagc
caagagctaccgaatttcttaaccatacctggctacgactacttgccgtag

DBGET integrated database retrieval system