KEGG   Vibrio cholerae M66-2: VCM66_1529Help
Entry
VCM66_1529        CDS       T00891                                 

Gene name
aldC
Definition
alpha-acetolactate decarboxylase (EC:4.1.1.5)
Orthology
K01575  
acetolactate decarboxylase [EC:4.1.1.5]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Butanoate metabolism
C5-Branched dibasic acid metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:vcm00650]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:vcm00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1647878..1648663
Genome map
AA seq 261 aa AA seqDB search
MNPLLSAHCSCSQEIAQQFAHYQHISGEGEIYQTSLMSALIAGVYEGATTIAQLLEHGDF
GLGTFNELDGELIAFDRQVFQLRADGSAQPAHPEQQTPFAVFTFFKADIELPITERMTRE
QVHQLIDRLVPSDNLFCAIRIDGTFPSVQTRTVPKQQRPYRPMLEVVKQQPVFRFQQQHG
VIAGFRSPQYTTGINVPGYHEHFITQQRTGGGHIQDYIIRSGFLQIGRVSRLVVDTPVSR
DFLEANLTPNNIRTAIEAAEK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctttactctctgcccactgttcatgctcacaagagattgctcagcaatttgcc
cactatcaacacatcagtggtgaaggcgagatttatcaaacctcattgatgagcgcctta
atcgctggggtttatgaaggtgcaaccaccatagcgcaacttttagaacatggggacttt
ggtctcggtacgtttaatgaactggatggcgaattgatcgcatttgatcggcaagtcttt
caactgcgcgctgatggttctgcccaacccgcacatcctgagcagcaaacgcctttcgcc
gtttttactttttttaaagcggatattgagctgcccattaccgaacgcatgactcgtgaa
caagtacatcagttgattgaccgattagtcccgagcgacaacctattttgtgcgattcgc
attgatggcacctttccgagtgtgcagacccgtactgtacctaaacaacagcggccctat
cgacctatgttagaggtggttaaacagcagcccgtttttcgttttcaacagcaacatggc
gtgattgccggatttcgcagcccgcaatacaccacaggcatcaacgtgcccggctaccac
gaacattttattactcagcaacgtacgggtggcggacacattcaagattacatcatccgt
tctggattcttacaaattgggcgagtttcgcgtttggtggtcgacactccggtgtctcgt
gactttcttgaggcgaacctcacccctaataacatccgtactgccatcgaagcagcggaa
aaataa

DBGET integrated database retrieval system