KEGG   Vibrio cholerae M66-2: VCM66_1529Help
Entry
VCM66_1529        CDS       T00891                                 

Gene name
aldC
Definition
alpha-acetolactate decarboxylase (EC:4.1.1.5)
Orthology
K01575  
acetolactate decarboxylase [EC:4.1.1.5]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Butanoate metabolism
C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VCM66_1529 (aldC)
   00660 C5-Branched dibasic acid metabolism
    VCM66_1529 (aldC)
Enzymes [BR:vcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     VCM66_1529 (aldC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1647878..1648663
Genome map
AA seq 261 aa AA seqDB search
MNPLLSAHCSCSQEIAQQFAHYQHISGEGEIYQTSLMSALIAGVYEGATTIAQLLEHGDF
GLGTFNELDGELIAFDRQVFQLRADGSAQPAHPEQQTPFAVFTFFKADIELPITERMTRE
QVHQLIDRLVPSDNLFCAIRIDGTFPSVQTRTVPKQQRPYRPMLEVVKQQPVFRFQQQHG
VIAGFRSPQYTTGINVPGYHEHFITQQRTGGGHIQDYIIRSGFLQIGRVSRLVVDTPVSR
DFLEANLTPNNIRTAIEAAEK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctttactctctgcccactgttcatgctcacaagagattgctcagcaatttgcc
cactatcaacacatcagtggtgaaggcgagatttatcaaacctcattgatgagcgcctta
atcgctggggtttatgaaggtgcaaccaccatagcgcaacttttagaacatggggacttt
ggtctcggtacgtttaatgaactggatggcgaattgatcgcatttgatcggcaagtcttt
caactgcgcgctgatggttctgcccaacccgcacatcctgagcagcaaacgcctttcgcc
gtttttactttttttaaagcggatattgagctgcccattaccgaacgcatgactcgtgaa
caagtacatcagttgattgaccgattagtcccgagcgacaacctattttgtgcgattcgc
attgatggcacctttccgagtgtgcagacccgtactgtacctaaacaacagcggccctat
cgacctatgttagaggtggttaaacagcagcccgtttttcgttttcaacagcaacatggc
gtgattgccggatttcgcagcccgcaatacaccacaggcatcaacgtgcccggctaccac
gaacattttattactcagcaacgtacgggtggcggacacattcaagattacatcatccgt
tctggattcttacaaattgggcgagtttcgcgtttggtggtcgacactccggtgtctcgt
gactttcttgaggcgaacctcacccctaataacatccgtactgccatcgaagcagcggaa
aaataa

DBGET integrated database retrieval system