KEGG   Vibrio cholerae M66-2: VCM66_1957Help
Entry
VCM66_1957        CDS       T00891                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.1.1.284)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VCM66_1957 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCM66_1957 (adhE)
   00620 Pyruvate metabolism
    VCM66_1957 (adhE)
   00650 Butanoate metabolism
    VCM66_1957 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    VCM66_1957 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    VCM66_1957 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VCM66_1957 (adhE)
   00626 Naphthalene degradation
    VCM66_1957 (adhE)
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VCM66_1957 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VCM66_1957 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2124637..2127321)
Genome map
AA seq 894 aa AA seqDB search
MPVTNLAELDALVARVKAAQAEFATFSQEQVDKIFRAASLAANQARIPLAQMAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNAAAKLVLDAAIAAGAPKDIIGWIDQPSVELSNA
LMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVSEVYDEVKERFATHKAHVLSKADADKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSYDDEFAHEKLSPTLGLFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKR
AFLVTDRFLFNNGYADDVVALLKAQGMEVQTFFEVEADPTLSVVEKGAAAMQSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPDTHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLIANVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQPGDRTAQKIERLLTWLDELKVNLDIPKSIQAAGVAEADFLAKVDELAVEAFDDQC
TGANPRYPLIAELKEVLLASYYGKPFVEGQTFEGTTVIVKKADQEAAKAPKAKK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttactaatctggctgaacttgatgctctggttgctcgcgttaaagcagctcaa
gctgaatttgctactttctctcaagaacaagtagacaaaatcttccgcgcagcctctcta
gcagcaaaccaagcacgtatcccgttagcacaaatggcggtagaagaatcaggtatgggt
attgttgaagataaagtaatcaaaaaccactttgcttctgagtttatctacaacaagtac
aaggacgaaaaaacctgtggcatcctcgaagaagatgacaacctaggtactatgactatc
gctgagcctgttggcatcatctgtggtatcgtcccaacgactaacccaacctcaaccgcg
atcttcaaatcactgatttctctgaagactcgtaacggtatcatcttctctccacaccca
cgtgcgaaaaactcaaccaacgcagcagcgaaactggttctggatgccgcaatcgcagcg
ggtgcaccaaaagacatcatcggttggattgaccaaccttcagttgagctgtcaaatgct
ctgatgaaacacgatggtatcgcactgatccttgcgacgggtggtcctgggatggtgaaa
gcggcttactcttctggtaaaccagccatcggtgtaggtgcaggtaacgttccagttgtt
atcgatgaaactgcagatatcaaacgtgcggttgcttctatcctgatgtctaaaacgttc
gacaacggtgtagtgtgtgcttctgagcaagcggctatcgtagtgagcgaagtttacgac
gaagtgaaagagcgtttcgcaacgcacaaagcgcacgtcctgagcaaagcggatgcagac
aaagtgcgtaaagtgctgctgattgatggcgctctgaacgcgaagatcgtaggtcaacct
gctgctgctatcgctgaaatggcaggcgtaaaagtacctgcagatactaaagtgctggtg
ggtgaaggtctgggcaaagtctcttatgacgatgaattcgctcacgagaaactgtctcca
acacttggcctgttccgtgctgacaacttcgaagacgcggttgctcaagcggtgactatg
gttgagatcggcggtatcggtcacacctcaggtctgtacaccaaccaagacgttaacgca
gaccgtatccgttactttggtgataaactgaaaactgcccgtattcttgtcaacatcccg
accactcacggtggtatcggtgatctgtacaacttcaacgttgcaccgtctctgactctg
ggttgtggttcttggggtggtaactcaatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaacatgttgtggcacaaactacctaagtct
atctacttccgccgtggtagccttccaatcgccctgagcgacctagaaggtaaaaaacgc
gcattcctagttactgaccgtttcctattcaacaacggttatgcagacgatgtggttgcc
ctgctgaaagcacaaggcatggaagttcagacattcttcgaagtagaagcggatccaaca
ctgtctgtcgtagaaaaaggcgctgcagcaatgcaaagcttccaaccagatgtgattctt
gcgctaggtggtggttcaccaatggatgcggcgaagatcatgtgggtaatgtacgagcac
ccagatactcactttgaagaactggctatgcgctttatggacatccgtaagcgtatctac
aagttccctaaaatgggtaaaaaagcagagcttgtttgtatcactaccacttcaggtacg
gggtcagaagttacaccattcgcggttgtgactgacgacaagactggcgctaagtaccca
ctggcagactacgaactgacaccacaaatggcgatcgtagatgcgaaccttgtgatgaac
atgcctaagtctctgaccgctttcggtggttacgatgcggtaactcacgcactcgaagct
tatgtatccgttcttgcgaacgaatactcagacggtcaagcactacaagcgctgaagatg
ctgaaagagtacctaccttctagctacgcgaatggtgcgaaagatccaatcgctcgtgag
aaagtacacaacgcagccactatcgctggtatcgcattcgcgaacgcgttcttgggtgta
tgtcactcaatggcgcacaaaatcggtgctgagttccacctaccacacggtttggcgaac
gctctgctgattgctaacgtagtacgttacaacgcgaacgacaacccaaccaaacaaacg
gcattctctcaatacgaccgtccacaagcacgtcgtcgttacgcagaagtggcggaccac
ttaggtctgagccaaccgggtgaccgtactgcacagaagattgagcgtctgctgacttgg
ttggatgaactgaaagttaacctagacattccaaaatcaatccaagctgcaggtgtagca
gaagcagacttccttgcaaaagtggatgagctagcggttgaagcgtttgatgaccaatgt
actggtgcaaacccacgctacccactgatcgctgagctgaaagaagttctgctggcttct
tactacggtaagccattcgttgaaggtcaaactttcgaaggcaccactgttatcgtaaag
aaagcagatcaagaagcggcgaaagcgccaaaagcgaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system