KEGG   Vibrio cholerae M66-2: VCM66_2261Help
Entry
VCM66_2261        CDS       T00891                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcm00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vcm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vcm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2424516..2427650)
Genome map
AA seq 1044 aa AA seqDB search
MYAVEQRRYWLVASRIQEDLMRNFSDILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEAR
LDVGGNRQSLNGQWRFALFEKPEAVEPAVIDPDFDDSAWAHIPVPSNWQMQGFDKPIYTN
IQYPFADRPPYVPQDNPTGCYRHRFTLEKQALTESIRIVFDGVNSAFHLWCNGHWVGYSQ
DSRLPAEFELTPYLQEGENLLVAMVLRWSDGSYLEDQDMWWLSGIFRDVYLYRKPILAIE
DFFIRTELDALYQHAELRVETRLSQVTRHHQVQVALFDAQGECVARSQALHTGQRVVDEK
GAWHDKTEHSLAICSPTLWSDEAPYLYRCVICLLDEDGAPIEFESAAVGFRKVEITQGLL
KLNGQPLLIRGVNRHEHHPELGHVMDEASMRRDIELMKQHNFNAVRTAHYPNHPRWYELC
DEYGLYVVDEANLETHGQFPMSRLSNDPQWVNAYLQRMIGMVERDKNHPCVIIWSLGNES
GIGTNHHAMYQWTKQRDPSRPVQYEGGGANTAATDIVCPMYARVDQHQPHPAVPKYALKN
WISLPQENRPLILCEYAHAMGNSLGAFYKYWQAFREFPRLQGGFIWDWVDQGISKWDSEG
RHYWGYGGDFGDTINDRQFCINGLLFPDRTPHPALHEVKKVQQPYQFSLSYPKLTIHNER
LFAALPLELVVSVLCDGQEIKQERLPLDIAPRGTITLDLASLPMLPEHEYHLNAVLLCRE
DQPWSNAGHCIASEQWCLQPRRSMLPKITHAPLPQWQQDGDKVRIEAANQQWQFNRQTGL
LEQWWQNGQPVLSEPLRDNFYRAVLDNDIGTSEAQHLDPNSWIARWHAAGLDKLRVECDD
LRVTTLNESVEVVIDVAHYHQQALALRTRWRYQIFGDARVELNVEVMLCSDLPPLPRVGL
TLALPVAENPVSWFGRGPHENYPDRLQSAHVGRYTATVDELHTPYIFPSENGLRCDTRQL
QVGALVVEGHFHFSLSRYSQTMLDKAKHSNELVAGDKWYLNLDAQHMGVGGDDSWSQSVH
PEFLLTQPHYQYQLTLRVKASSPQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccgtagagcaaaggcgttattggcttgttgcttcgcgtattcaagaggatctt
atgcgcaacttctccgatattcttcttagccaagattggcaaaacccgcacatcgttaaa
tggcactgccgtacaccccatgttcctttgcacagttatcgcactgagcaggaggctcgt
ttggatgttggggggaatcgccaatctctaaatggtcagtggcggtttgctctgtttgag
aagccagaagcggttgagcctgcggtgatagacccggatttcgatgatagcgcttgggcg
cacattcctgtaccgagtaactggcagatgcaaggctttgataagccgatttacaccaat
atccaatatccatttgcggatcggccgccttacgtgccgcaagataatccaaccggctgt
tatcgccaccgttttacactggaaaaacaagcgctaaccgagtccattcgcattgtattt
gatggggtcaattcggcatttcatctgtggtgcaatggtcattgggtcggttattcgcaa
gatagccgcttgcctgccgagtttgagttaaccccttatctacaagagggtgaaaacctg
ttggtggccatggtgctgcgctggtctgatggctcttatttggaagaccaagatatgtgg
tggctgagtggcatctttcgcgatgtgtatctctaccgcaagccgatactcgcgattgaa
gatttttttatccgcactgaattagatgcgctttatcaacacgctgaattgcgagtagaa
acacgcttaagccaagtgactcgccatcatcaagtgcaagtggctttattcgatgcacaa
ggtgaatgcgtggcgcgttcacaagccttacatacaggccagcgtgtagtggatgaaaaa
ggagcatggcacgataaaaccgaacacagtttagcgatttgctctccgacactgtggagt
gatgaagcgccttatctttaccgctgcgtgatctgtttgcttgatgaagatggcgcgccg
attgagtttgaaagtgcagcagtgggttttcgcaaagtagaaatcactcagggactactg
aagctcaatggtcagcccttgttgatccgcggggtgaaccgtcatgaacatcatcccgaa
ttggggcatgtgatggatgaagcaagcatgcgccgcgatattgaattgatgaaacagcat
aatttcaatgcggtgcgtaccgcccattaccccaatcatccgcgttggtacgaactgtgt
gatgagtacggtttgtatgtggtggatgaggccaatctcgaaacccacggccaatttccg
atgagccgactttccaatgatccacaatgggtgaatgcctatttgcagcgcatgattggc
atggtggagcgcgataaaaaccacccttgtgtgatcatttggtcgctcggcaatgaatcg
gggattggtaccaatcatcacgccatgtatcagtggacgaaacagcgcgacccatcgcgt
cctgtgcaatacgaagggggcggcgctaatacggcggcgaccgatattgtttgcccgatg
tatgcgcgggtcgatcagcatcagccacatcctgcggttccaaaatatgcgctgaaaaat
tggatcagtttgccgcaggaaaaccgccccctcatcttgtgtgaatatgctcatgcgatg
ggcaacagcttgggcgcgttttataaatactggcaggcgtttcgtgagtttcctcgtctg
caaggtggctttatttgggattgggtcgatcagggcatttccaaatgggatagcgagggg
cgccactattggggctatggcggtgattttggcgatacgattaacgatcgccaattctgc
ataaacggtttgctgttcccagatcgcacgccgcatccggcattacatgaagtcaaaaaa
gtccagcagccgtaccagttttcgttgagctatcccaagctcaccattcacaatgagcgc
ttgtttgcagcgctgccgctggagctggtagttagtgtgctatgcgatgggcaagagatt
aagcaagaacgtctgccgcttgatattgcgccgcgcggcacaatcacgctggatttagcg
tcgctgccaatgttgccagagcatgaataccacctcaatgcagtcttattgtgtcgtgag
gatcagccatggtctaacgcggggcactgcatcgctagtgagcagtggtgtttgcagcca
cgaagaagcatgttacctaaaatcacacacgctccgctgcctcaatggcagcaagatgga
gataaggtgcgcatcgaggcggccaatcagcaatggcagtttaaccgccaaactgggcta
ttggagcagtggtggcaaaatggtcagcccgtattgagtgaaccgctgcgcgataacttt
taccgcgcggtgctggataacgatattggtactagcgaagcgcagcatcttgacccgaac
agctggatcgcacgttggcatgcggcgggcttagataagctgcgtgtggaatgtgacgat
cttcgcgtcaccaccttgaacgagagtgtcgaagtggtgatcgatgtcgcccattaccat
cagcaagcgttagcgcttcgtacccgttggcgttaccaaatcttcggtgatgcgcgggta
gaactgaatgttgaggtgatgctgtgttctgatttaccgccgctgccaagagtggggtta
acgctcgcattaccagtggcagaaaacccagtgtcttggtttggtcgcgggccgcatgag
aattatccggatcgtttgcaatcggcgcatgtggggcgatacaccgccacggtggatgag
ctgcatacaccgtacattttcccgagcgaaaatggtttgcgttgtgatactcgccagcta
caagtgggcgctttggtggtggaagggcattttcacttctcgctcagtcgctactcacaa
acgatgttggataaagccaaacacagcaacgagttggtggcgggcgataagtggtatctc
aatctggatgcgcagcatatgggcgtgggcggcgatgattcgtggagccaaagtgtgcac
cctgaatttttgctcactcagccgcactatcagtatcagctcaccttacgtgtgaaagcg
tcatccccacaataa

DBGET integrated database retrieval system