KEGG   Vibrio cholerae M66-2: VCM66_2272Help
Entry
VCM66_2272        CDS       T00891                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2442653..2444080)
Genome map
AA seq 475 aa AA seqDB search
MCLRAARGFALLNLFTLRSFFGNWEAAMSLSQAKYLPQEIIRRKRDGEVLTNDEINFFIQ
GVANNTVSEGQIAAFAMAIFFREMTMPERIALTCAMRDSGMVIDWSHMNFDGPIVDKHST
GGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYNITPTNDVFGKVTK
QAGVAIIGQTGDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGS
GAFMPTYEASEELAKSIVAVANGAGTNTTAILTDMNQVLASSAGNAVEVREAVRFLTGEY
RNPRLLEVTMASCAEMLVLGKLAKDTAQAREKLQAVLDNGQAAERFGKMVAGLGGPSDFV
ENYDKYLAKAEIVRPVYAQQSGVISAMDTRAIGMAVVGMGGGRRVATDRIDYAVGFDQFI
RLGEIADSNKPLAMIHARNEEQWQQAANALQSAIKVGGDYLPTPDVYRQIRAQDV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtctgagagcagcgcgaggcttcgcgctgcttaacctctttacactacgcagtttc
tttgggaactgggaggcagctatgtctttatctcaagcaaagtatttacctcaagaaatt
atccgcagaaagcgtgatggtgaagttctcaccaacgatgaaatcaacttcttcattcaa
ggtgtggcgaataacaccgtctctgaagggcaaattgccgcgtttgcgatggcgattttt
ttccgtgaaatgactatgcctgagcgtattgcactgacgtgcgcgatgcgcgattccggt
atggtgattgattggagccacatgaattttgatggtccgattgtggataaacactccacg
ggcggcgtgggcgatgtgacctcactgatgcttggccctatggtggcagcctgtggcggt
tatgtgccgatgatttctggccgcggccttggtcacactggggggacgctcgacaaactt
gaagccatccccggctataacattaccccaaccaatgacgtgtttggcaaagtgaccaaa
caagccggcgtggcgatcatcggccaaactggcgatctggctccggcggataagcgtgtg
tacgcaacgcgtgatattaccgcgacagtggataacatctcgctgatcaccgcttcaatt
ctttctaagaaactggcggctggccttgaatcgctcgtgatggatgtgaaagttggctct
ggtgctttcatgccaacttacgaagcgtctgaagagctcgccaaatcgatcgtggcagtg
gccaacggtgcaggcaccaataccacggcgatcttaactgatatgaaccaagtgctggcg
tcttcagcgggtaacgcggtggaagtgcgtgaagcagtacgcttcctcaccggcgaatac
cgtaatccgcgtctgctggaagtcactatggcgtcgtgtgcggaaatgctggtacttggc
aagttagccaaagataccgcgcaagcgcgtgagaaactgcaagcagtgctggataacggc
caagccgccgagcgttttggcaaaatggtcgcaggcctcggtggcccaagcgattttgtt
gaaaactacgacaagtatcttgcgaaagctgagattgttcgcccagtttacgctcagcaa
tctggcgttatttctgcgatggatacccgtgccatcggcatggcggtggtcggcatgggc
ggtggccgccgcgtggcgaccgatcgtatcgattacgctgtcggttttgatcagtttatc
cgtctgggtgaaatcgccgacagcaacaaacctttagcaatgattcatgcccgtaatgaa
gagcagtggcaacaagctgccaatgcactacaaagtgcgattaaagtgggcggtgattac
ctaccaacaccggatgtttaccgtcaaattcgagcacaagacgtgtaa

DBGET integrated database retrieval system