KEGG   Vibrio cholerae M66-2: VCM66_2336Help
Entry
VCM66_2336        CDS       T00891                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00010  Glycolysis / Gluconeogenesis
vcm00020  Citrate cycle (TCA cycle)
vcm00620  Pyruvate metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01130  Biosynthesis of antibiotics
vcm01200  Carbon metabolism
Module
vcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCM66_2336 (aceF)
   00020 Citrate cycle (TCA cycle)
    VCM66_2336 (aceF)
   00620 Pyruvate metabolism
    VCM66_2336 (aceF)
Enzymes [BR:vcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VCM66_2336 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ACP06634
UniProt: C3LQV6
Position
I:complement(2520017..2521930)
Genome map
AA seq 637 aa AA seqDB search
MKVGKVMAIEIYVPDIGADEVEVTEILVKVGDKVAEEQSLITVEGDKASMEVPASQAGIV
KEIKVVAGDKVSTGSLIMVFEAEGAAAAAPAPAPQAAAPVAAAPAAAALKEVQVPDIGGD
EVEVTEIMVKVGDVVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMV
FEVAGAAPVAAPVQAAAPAAAAAPAVAALKEVQVPDIGGDEVTVTEIMVNVGDSISEEQS
LITVEGDKASMEVPAPFAGTLKEIKVAAGDKVKTGSLIMVFEVAGAAPVAAPVQAAPAPA
PAAAPAQAAAPAAAAPATSGEFQENHEYSHASPVVRRLAREFGVNLAKVKGSGRKNRILK
EDVQNYVKEALKRLESGAQAAASGKGDGAALGLLPWPKVDFSKFGDTEVQPLSRIKKISG
ANLHRNWVMIPHVTQWDNADITELEKFRQEQNAMEAKRDTGMKITPLVFIMKAAAKALEA
FPAFNSSLSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSKELAEVSKKA
RGGKLTAADMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKEFAPRL
QLPLSLSYDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtaggaaaagtaatggcaatcgaaatttatgtacctgacatcggtgcggatgag
gttgaagtcactgagattctcgtcaaagtcggcgacaaagtggctgaagagcaatctctg
atcacggttgaaggcgacaaagcttctatggaagttcctgcgtctcaagcgggtatcgtt
aaagagatcaaagtagtggcaggtgacaaagtgtctactggctctctgatcatggtcttt
gaagcggaaggtgcagcagcggcagcaccagctcctgcgcctcaagcggcagcaccagtt
gctgcggctccagcggccgctgcactgaaagaagtgcaagtaccagacattggcggtgat
gaagttgaagtgactgaaatcatggtcaaagtgggcgatgtggttgcggaagagcaatct
ctgatcaccgttgaaggcgacaaagcgtcaatggaagtacctgcacctttcgctggtacg
gttaaagagatcaaaatcgctgcgggcgacaaagtatcaacaggttcactgatcatggtg
tttgaagtagccggtgctgcgccagttgcagcaccagttcaagctgcggcaccagcggca
gctgctgctccagctgttgcagcactgaaagaagttcaagtacctgatatcggcggtgac
gaagtgaccgtaacggaaatcatggttaacgtgggcgacagcatcagcgaagagcaatct
ctgatcaccgtagaaggcgataaggcttctatggaagtaccagcaccttttgctggaact
ctcaaagagatcaaagtggctgcaggcgataaagtgaaaacaggttcgctgatcatggtg
tttgaagttgctggcgcagcgccagtcgcggcaccagttcaagcagcaccagcaccagca
cctgcggcagcgcctgctcaagcagcagctcctgcggcggctgcacctgcaacaagtggt
gaattccaagaaaaccatgagtactcacacgcttctccagtcgtgcgtcgtctggctcgt
gaatttggtgttaacctagccaaagtcaaaggctctggccgcaagaaccgtatcctgaaa
gaagacgtacagaactacgtgaaagaagcgctgaaacgtctggaatctggcgcgcaagcg
gcggcttcaggtaaaggtgatggcgcagcgctgggcttactgccttggccaaaagtggac
ttcagcaagttcggtgataccgaagtgcaaccactgtctcgcatcaagaaaatctcgggt
gctaacctgcaccgtaactgggtgatgatcccgcacgtgacccaatgggacaatgcagac
atcactgagctagagaaattccgtcaagagcaaaacgcgatggaagcgaagcgcgacact
ggcatgaagatcactccgctggtgttcatcatgaaagccgctgcgaaagcgctggaagct
ttccctgcgttcaactcttctctgtctgacgatggcgaaagcttgatcctgaagaaatac
gtgaacatcggtattgcagtggatacaccaaatggtctggtggttcctgtgtttaaagat
gtgaacaagaaaggcatctacgagctgtcaaaagagctggctgaagtctcgaagaaagcc
cgtggcggtaagctgactgccgctgacatgcaaggtggctgtttcactatctctagccta
ggcggtattggcggtacagcgtttaccccaatcgttaacgcacctgaagtggctattttg
ggtgtgtctaagtctgagatgaagccagtgtggaacggcaaagagttcgcgccacgtctg
caactgccactgtcactgtcttacgatcaccgcgtgatcgacggtgcagaaggtgcacgc
ttcattacttacctgaacgagtgtctaagcgacatccgtcgtctggtactgtaa

DBGET integrated database retrieval system