KEGG   Vibrio cholerae M66-2: VCM66_2341Help
Entry
VCM66_2341        CDS       T00891                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vcm  Vibrio cholerae M66-2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2529642..2530394)
Genome map
AA seq 250 aa AA seqDB search
MSVLRRLTWLAFPLLSMAFNVQANTAPAQLNKAELEQRFAKLGLQVEEIKTSDINGLLEV
QTSGGVLFSSPDGEHFIAGTLYALDGNGGYVDVLAKRQAPLNAKKIAALQDSMIEFKAPN
EKYAITVFTDITCGYCVRLHSQIKEYNDLGITVRYLAYPRQGPQGQVADQMAAIWCSNDP
KAAMHDAKVNRKTITADKDIAQCQKTIAQHYMLGHELGISGTPAIFLPNGEMVGGYLPAP
QLLQRLQATQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgcgccgactaacatggctggcatttcctttactgagtatggcattcaac
gtacaagcgaacactgcaccagcacaattgaataaagccgagcttgagcagcgctttgcc
aaactcggattgcaagtggaagagataaaaacctctgatatcaatggcttgcttgaagtg
caaacgtctggtggtgtgttgttctcttcgcctgatggtgagcactttatcgcgggtact
ctgtatgcgctggatggtaatggcggttatgttgatgtgctggctaaacgccaagcgcca
ctcaacgccaagaaaattgccgcattgcaagacagcatgattgagtttaaagcgcccaat
gagaaatacgcgatcaccgtatttaccgatatcacgtgtggttactgtgtgcgtctgcac
agccagatcaaagagtacaatgatctcggcattacggtgcgttatctcgcctacccgcgt
caggggccgcaaggtcaagtcgcggatcaaatggcggccatctggtgttctaacgatccg
aaagcggcgatgcacgatgcgaaagtgaatcgtaaaaccattaccgccgataaagatatc
gcccaatgccaaaagaccatcgcgcagcactatatgctgggtcacgagctcggcattagc
ggtactccagcgattttcttacccaatggtgagatggttggcggctatttgcctgcgccg
caattgctgcaacgcctgcaagccacacaatag

DBGET integrated database retrieval system