KEGG   Vibrio cholerae M66-2: VCM66_2590Help
Entry
VCM66_2590        CDS       T00891                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:vcm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vcm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:vcm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:vcm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2774354..2775151
Genome map
AA seq 265 aa AA seqDB search
MIRYGDIPMRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVEGVDVVVAPPAMYLDLAER
LIKEGGNKLILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVA
KKFAFLKENGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIW
AIGTGKAATADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGA
LVGGASLDAKGFAAIAKAAAEAKKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgattagatatggagatattcctatgcgtcgtcctgttgtgatgggtaactggaaactg
aatggcagcaaagctatggtcactgacctgctaaacggtttgaatgcagaacttgaaggt
gttgaaggtgttgatgttgtcgttgcgccaccagcaatgtatttggatctggctgagcgc
ctgatcaaagaaggcggcaacaagctgatcctgggtgcacaaaacaccgatactcacaac
agtggtgcgtacacaggtgatatgtctcctgcgatgctgaaagatttcggtgcttcgcac
atcatcatcggtcactctgagcgtcgtgattaccacaaagaatcagatgagttcgtcgct
aagaaatttgcgttcctgaaagaaaacggcctaacgccagtcttctgtatcggtgaaact
gaagcgcaaaacgaagcgggcgaaacagaagcggtatgtgctcgccaaatcaacgcagtg
atcgatgcttacggcgttgaagcactgaacggcgcgatcatcgcttacgaaccaatctgg
gcaatcggtacgggtaaagccgcgacagcagatgatgcacagcgtatccacgcgtcaatc
cgtgcactgatcgctgcgaaagatgctgcagtggctgagcaagtgatcatccagtacggc
ggttccgtaaaaccagaaaacgcagcgtcttactttgcacaaccagacatcgatggtgcg
ctggttggcggtgcatcactggatgcgaaaggctttgccgcgatcgccaaagccgcagca
gaagcgaaaaaagcgtaa

DBGET integrated database retrieval system