KEGG   Vibrio cholerae M66-2: VCM66_2609Help
Entry
VCM66_2609        CDS       T00891                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCM66_2609 (pfkA)
   01230 Biosynthesis of amino acids
    VCM66_2609 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCM66_2609 (pfkA)
   00030 Pentose phosphate pathway
    VCM66_2609 (pfkA)
   00051 Fructose and mannose metabolism
    VCM66_2609 (pfkA)
   00052 Galactose metabolism
    VCM66_2609 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VCM66_2609 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VCM66_2609 (pfkA)
Enzymes [BR:vcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VCM66_2609 (pfkA)
Protein phosphatases and associated proteins [BR:vcm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VCM66_2609 (pfkA)
Messenger RNA biogenesis [BR:vcm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VCM66_2609 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2793908..2794903)
Genome map
AA seq 331 aa AA seqDB search
MIFDSQSSRVSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDR
IKQLDRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMG
AKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEI
MGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDAN
KLAKEIESATGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQK
EQLVHHDIIDAIENMKRPVRTDLYKVAEELF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcgattcgcaaagttcgagggtgagcatgattaaaaaaatcggtgttttgacg
agtggtggcgatgccccaggtatgaatgcagctattcgcggcgtggtgcgtacagcactt
ggcgcaggtttagaagtgtttggtatttacgacggctaccaaggtctgtacgaagatcgt
attaagcagctagaccgttcaagcgtgtctgacgtgatcaaccgtggcggtactttttta
ggctctgcacgcttcccacaatttcgtgaagttgaagtgcgcgaaaaagcgattgaaaac
ctgaaaaagcacggcattgaagcgctggttgtgattggtggtgacggctcttacatgggc
gccaaaaaactgaccgaaatgggtttcccttgtatcggtctgccaggcacgattgataac
gatatcgcgggcaccgactacaccatcggttatttgactgccctgaacaccgttattgaa
gcgattgaccgtctgcgcgatacctcttcttcacaccaacgtatctctatcgtagaaatc
atgggtcgtcactgtggtgacttgacgctgacctctgcgattgcgggtggctgtgaatac
atcatcacaccggaaacgggtctgaatatggagcagctgatttccaatatcaaagatggt
attgcgaaaggcaaaaagcacgcgatcattgcgctgactgagctgatgatggatgccaac
aaactggccaaagagattgaatcggcgacaggccgtgaaactcgcgcaactgtattaggc
catattcaacgtggtggtaaacctaccgcatttgaccgtgtactggcatcgcgcatgggt
aactacgcggtgcatctattgatggaaggtcacggtggtcgttgtgtgggtatccagaaa
gagcaactggttcaccacgacatcattgatgcgattgaaaacatgaagcgtcctgtacgc
actgacctgtacaaagtcgctgaagagctgttctaa

DBGET integrated database retrieval system