KEGG   Vibrio cholerae M66-2: VCM66_2678Help
Entry
VCM66_2678        CDS       T00891                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VCM66_2678 (fadB)
   01212 Fatty acid metabolism
    VCM66_2678 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VCM66_2678 (fadB)
   00650 Butanoate metabolism
    VCM66_2678 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VCM66_2678 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VCM66_2678 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCM66_2678 (fadB)
   00310 Lysine degradation
    VCM66_2678 (fadB)
   00380 Tryptophan metabolism
    VCM66_2678 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VCM66_2678 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VCM66_2678 (fadB)
   00281 Geraniol degradation
    VCM66_2678 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VCM66_2678 (fadB)
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VCM66_2678 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VCM66_2678 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VCM66_2678 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VCM66_2678 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2873698..2875869
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
TETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQSFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQV
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagcgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaagccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttatcagcgttaaaaggccatacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggcgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagcgttaaaa
gtgggattactggatgcgattgtcgatagcgacaaactgatcgattccgcaatcaccact
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactctaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacacttcatcaagctc
gcaaaatctaccgaggcacaagcgctggttggtattttcctcaatgatcaatacatcaaa
ggtctagccaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggcggcggcatcgcctatcaatcggctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagaactgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggtttcaaaatggctggcattctggct
tccatcaccccttctctgcattacgctgggattgatcaggcggatgtgattgttgaggcc
gtggtggaaaatccgaaagtaaaagccgcggtactgagcgaagtggaaggattggtcgat
acagaaacaattctgacctccaacacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccatcaaccgagtggttgct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgattgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgcaaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggcccggcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggcggaaggc
ttcccaactcgcatggcgaaaagcggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggcaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaagctttgacccacaaacccttattgaacgcactatgattccgatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtattccgttacttagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagtc
agtgccctgtaa

DBGET integrated database retrieval system