KEGG   Vibrio cholerae M66-2: VCM66_A0574Help
Entry
VCM66_A0574       CDS       T00891                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(525247..525939)
Genome map
AA seq 230 aa AA seqDB search
MSAIRKGYLRGRGMSGLSESAKLVKDALERRGLETPMQPNLATPAEKKEKIEQHMREILN
LLGLDLTDDSLEETPQRIAKMYVDEIFSGLDYANFPKITVIENKMKVSEMVKVKDITLTS
TCEHHLVTIDGTAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLES
DDVAVTIDATHYCVKSRGVMDATSVTTTTALGGIFKSNPATRAEFLHGLR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagccatccgaaaggggtatttaagaggtagaggaatgtcaggtcttagcgaatcc
gcgaagttggtgaaagatgcgctagagcgccgagggttggaaacaccaatgcagcccaac
ttggcgacaccagcagagaaaaaggaaaaaatcgaacagcatatgcgtgagatcctcaac
ctgctcggactggacttaacggatgacagtttggaagaaaccccacaacgcatcgctaag
atgtatgtggatgagatcttctcagggttggattatgccaacttccccaagatcactgtt
atcgaaaataagatgaaagtgagtgagatggttaaagtgaaagacatcacactgaccagc
acgtgtgaacaccacttagtcaccatcgatggcacggcagcggtggcgtacatcccgcgc
ggcaaaatcatcggcttatcgaaaattaaccgtattgtgcgcttttttgcccagcgtccg
caggtgcaagagcgtatgacgcagcagatcttagttgcgctgcaaacgttgcttgagtcg
gatgatgtggcagtcaccatcgatgcgactcactattgcgtgaaatcccgcggcgtgatg
gatgcaaccagcgtcaccacaacgaccgctttgggggggatttttaaatctaaccctgcg
acgcgtgcggaattcctacacggtttgcgctaa

DBGET integrated database retrieval system