KEGG   Vibrio cholerae M66-2: VCM66_A0742Help
Entry
VCM66_A0742       CDS       T00891                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vcm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:700826..701473
Genome map
AA seq 215 aa AA seqDB search
METNLDSDCAEMMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSL
LAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQT
VTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQ
VILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggagactaatttggatagtgattgcgctgaaatgatggatgtttgcatgactcgacta
ctttcctttttgtttgttgttctcttttctgctgcagccagcagtaaaacgttattggta
ctcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagcttggccaagttta
ctggccgaagagctagtggaacagggtcaaaccgttaccgtagttaacggaagcatttct
ggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagccaacatcagccc
gataccgtactgatagaattaggagccaacgacggtttacgcggttttccaccgcaaacg
gtcactcataacctcaccaccatgattgaacagatccaagctaaaaacgcaaaagtcatc
ttaatgcagatccgtatcccacctaactatggcaaacggtacagcgatgcgttttaccag
atctatcctagcctagctgagcagttttctatcccgcttatcccgttctttcttgagcaa
gtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaacctgaagcgcag
ccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system