KEGG   Vibrio cholerae M66-2: VCM66_A0916Help
Entry
VCM66_A0916       CDS       T00891                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vcm  Vibrio cholerae M66-2
Brite
Enzymes [BR:vcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VCM66_A0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:878888..879907
Genome map
AA seq 339 aa AA seqDB search
MMTTEDFKKSTANLKKVVPLMMKHHVAATPVNYALWYTYVDQAIPQLNAEMDSVLKNFGL
CPPASGEHLYQQYIATKAETNINQLRANVEVLLGEISSSMSDTLSDTSSFANVIDKSFKD
LERVEQDNLSIEEVMTVIRRLVSDSKDIRHSTNFLNNQLNAATLEISRLKEQLAKVQKDA
LFDSLSGLYNRRAFDGDMFTLIHAGQQVSLIMLDIDHFKALNDNYGHLFGDQIIRAIAKR
LQSLCRDGVTAYRYGGEEFALIAPHKSLRIARQFAESVRRSIEKLTVKDRRSGQSVGSIT
ASFGVVEKIEGDSLESLIGRADGLLYEAKNLGRNRVMPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaactgaagatttcaaaaaatccacggctaacttaaaaaaagtcgtaccttta
atgatgaaacatcatgtcgcggccacccccgtgaactatgccttgtggtatacctacgtc
gaccaagccattccgcaactgaatgcggaaatggactctgtattgaaaaattttgggctt
tgcccacccgcttctggtgaacatctttaccaacaatacattgcgaccaaagcagaaacc
aatattaatcagttacgtgcgaatgttgaggtacttcttggtgaaattagcagttcaatg
agtgatacgctcagtgacaccagttcctttgctaatgtgattgataaaagctttaaggat
ttagagcgcgtcgagcaagacaatctctcgattgaagaagtaatgacggtgatccgccgc
ttggtgagtgactctaaagatattcgacactcaaccaatttcctaaataatcaactgaac
gcggcaacactagaaatctctcgtcttaaagagcagctggcgaaagttcagaaagatgct
ctgtttgacagtttatctggactctataaccgccgagcttttgatggcgatatgttcacg
ctgatccatgcaggtcaacaagtcagcctgatcatgctcgacatcgaccacttcaaagcc
cttaatgataactatggccacctgtttggtgaccaaattatccgtgcgatcgccaaacgt
cttcaaagcctatgccgtgacggcgtgacagcttatcgttatggcggtgaagagtttgca
ctgattgctccgcacaaatcgctgcgtattgcacgccagtttgctgaatcggtgcgacgt
tcaatagaaaagctcaccgtaaaagatcggcgtagcggtcaatcggtcggtagcattacc
gcttcgtttggtgtagtagaaaagattgaaggtgactctttggagtctcttatcggtcga
gcggatggattgctgtatgaagcgaaaaatctgggccgcaatcgagtcatgccgctctaa

DBGET integrated database retrieval system