KEGG   Vibrio cholerae M66-2: VCM66_A0917Help
Entry
VCM66_A0917       CDS       T00891                                 

Definition
(GenBank) malate synthase-related protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00620  Pyruvate metabolism
vcm00630  Glyoxylate and dicarboxylate metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01200  Carbon metabolism
Module
vcm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCM66_A0917
   00630 Glyoxylate and dicarboxylate metabolism
    VCM66_A0917
Enzymes [BR:vcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VCM66_A0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACP07876
UniProt: C3LWM1
Position
II:complement(880026..880634)
Genome map
AA seq 202 aa AA seqDB search
MTLNLDEGTTMNMLTFDKTEIQHQNKPFIAEAVFAVETVAANQQREKQTKAKQLLDRLFP
LENGTHQDVTAYVIDYNHLLAYFQDGRHSGLKYPKQFVAFNGSKENPSHLLFRDGQGSHV
EMTLGCQRGTGCIELREIADIQLETCTVLNHSNDHAQPSTTIRHWVSLIKGDEQGRPQAR
IEEKEYTARNGDEYFLGDCFSH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaatctggacgagggaacgacgatgaacatgctgacgtttgataaaacagaa
atccaacaccaaaacaaaccctttatcgctgaagctgtgttcgccgtagaaacggtcgcc
gccaatcaacagcgtgaaaaacaaaccaaagccaaacagttattggatcgtctgtttccg
cttgaaaatggtactcaccaagatgtgaccgcatacgtgatagattacaaccatctgctc
gcttactttcaagatggacgtcatagtggcttgaaatacccaaaacagtttgtggcgttt
aatggcagtaaagaaaatccaagccatcttctgtttcgtgatgggcaaggtagtcatgtt
gaaatgacattaggttgccagcgcggcacgggttgcattgagttacgagaaatcgcagac
attcaattagaaacgtgcacagtactcaatcattctaatgaccacgcacagccaagcacc
actattcgccactgggtaagtttgatcaaaggcgatgaacaaggtcgaccacaagctcgt
attgaagagaaagagtatacagctcgaaatggtgacgaatatttcctcggagactgtttt
tcacattaa

DBGET integrated database retrieval system