KEGG   Vibrio cholerae M66-2: VCM66_A1046Help
Entry
VCM66_A1046       CDS       T00891                                 

Gene name
cheB-3
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vcm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vcm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1018776..1019816)
Genome map
AA seq 346 aa AA seqDB search
MKKIKVLIVDDSPVFRALLTQLIDSDPALQVVASAEDPYQARELIKHYQPDVVTLDVEMP
KMNGVQFLKNLMRLHPLPVVMISTLTQHGAEATLAALELGAVDYFPKPSSDNPAEMLNYK
NLVNDKIKMAAQANVGFVQSATVSAPITERVSTDYQLIAIGSSTGGTEAVKQVLAALPSG
LPPIVMTQHIGAQFTASLAKRLNDSSALHVQEVTQPTTALESSCAYLAPGDKHIVVVKRA
GKLYVELDDRPAVNRHKPSVDVMFNSIAQHVGSKAMGILLTGMGQDGAKGMLAMHQQGAA
TAAQDEQSSVVWGMPRVAIELGAADVVKPLGAMATWIVEQLQKKHA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtcttgatcgtggatgattctccggtatttcgggctttattaacc
cagttgattgatagcgaccccgcgttgcaagtggtggcgagcgcagaagatccttaccaa
gcgcgtgaactgattaagcactatcaacccgatgtggtgaccttagatgttgaaatgccc
aaaatgaatggtgtgcagtttcttaaaaatctgatgcgccttcatccattacctgtggtg
atgatctccaccttaacccagcacggtgcggaagcaacgttggcggctcttgagttaggc
gctgtggattatttccccaaaccttcttcagataacccggctgaaatgctcaattataaa
aacttggtgaatgacaaaatcaaaatggcggcacaagccaatgtagggtttgtgcagagt
gcgacggtttcagcgcccattacggagcgagtttccaccgattaccagttgattgctatc
ggctcttctactggtggtacggaagccgtcaaacaagtcctcgcagcattaccttctggc
ttacctcctatcgtcatgactcagcatattggcgcgcagtttacggcctccttagcgaaa
cgattaaatgacagcagcgctctccatgtacaagaggtgacacaaccaacgacagcactt
gagagtagctgcgcctatctcgctccaggcgataagcatatcgtggtcgtgaaacgggct
ggcaaactttatgttgagttagatgacagacctgcggtgaatcggcacaaaccctcggtg
gatgtaatgtttaattcaattgctcagcatgtaggcagtaaagcgatggggattttgttg
accggcatgggacaagatggcgcgaaaggcatgttggcgatgcatcaacaaggagcggcg
accgcagcgcaggatgagcaatcaagcgtggtttggggcatgccgcgagtagcgatcgag
ctgggggctgcggatgtcgtcaaacctttaggggcaatggcgacttggattgttgaacaa
ctacaaaagaagcacgcataa

DBGET integrated database retrieval system