KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_101754Help
Entry
VOLCADRAFT_101754 CDS       T01330                                 

Gene name
hstH2B-8
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
vcn  Volvox carteri f. nagariensis
Brite
Chromosome and associated proteins [BR:vcn03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    VOLCADRAFT_101754 (hstH2B-8)
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VOLCADRAFT_101754 (hstH2B-8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 9621106
NCBI-ProteinID: XP_002947842
JGI: 101754
UniProt: D8TNF1
Position
Unknown
AA seq 154 aa AA seqDB search
MAPKKDEKTASQPADAEPKAEAKPKETKVKKEKKAPAKKAAKEPAAGGEEGDKKAKKKTK
VSKSETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASRLSRYNKKPTVT
SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaaaaggacgagaagaccgcatctcagccggctgatgccgagcccaaggct
gaggccaagcccaaggagaccaaggtgaagaaagagaagaaggcgccggccaagaaagcc
gcgaaggagccggctgccggtggcgaggagggcgacaagaaggctaagaagaagaccaag
gtttccaagagcgaaacctacaagctgtatatttacaaggtgctgaagcaggttcaccca
gataccggcatcagctccaaggctatgagcattatgaacagcttcatcaacgatattttc
gagaaggtcgccacggaggcctcccgcctgagccgctacaacaagaagcccaccgtcact
tctcgcgaaattcagacggccgtgcgcctggtgcttcctggcgagctggccaagcacgcg
gtgtcggagggcaccaaggccgttaccaagttcacttctgcgtaa

DBGET integrated database retrieval system